Shopping Cart
  • Remove All
  • TargetMol
    Your shopping cart is currently empty

SLC39A6 Protein, Macaca fascicularis, Recombinant (His)

TargetMol | SPR
Catalog No. TMPH-04525

SLC39A6 Protein, Macaca fascicularis, Recombinant (His) is expressed in in vitro E. coli expression system. The accession number is XP_005586923.1.

SLC39A6 Protein, Macaca fascicularis, Recombinant (His)

SLC39A6 Protein, Macaca fascicularis, Recombinant (His)

TargetMol | SPR
Catalog No. TMPH-04525
SLC39A6 Protein, Macaca fascicularis, Recombinant (His) is expressed in in vitro E. coli expression system. The accession number is XP_005586923.1.
Pack SizePriceAvailabilityQuantity
5 μg$31520 days
10 μg$52920 days
20 μg$89220 days
50 μg$1,18020 days
100 μg$1,47020 days
Bulk & Custom
Add to Cart
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.
Questions
View More

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
SLC39A6 Protein, Macaca fascicularis, Recombinant (His) is expressed in in vitro E. coli expression system. The accession number is XP_005586923.1.
Species
Cynomolgus monkey
Expression System
in vitro E. coli expression system
TagC-10xHis
Accession NumberXP_005586923.1
Synonyms
Zrt- and Irt-like protein 6,Zinc transporter ZIP6,Solute carrier family 39 member 6,SLC39A6
Amino Acid
MARKLSVILILTFTLSVTNPLHELKSAAAFPQTTEKISPNWESGINVDLAITTRQYHLQQLFYRYGENNSLSVEGFRKLLQNIGIDKIKRIHIHHDHDHHSDHEHHSDHEHHSDHEHHSHRNHAASGKNKRKALCPEHDSDSSGKDPRNSQGKGAHRPEHANGRRNVKDSVSTSEVTSTVYNTVSEGTHFLETIETPKLFPKDVSSSTPPSVTEKSLVSRLAGRKTNESMSEPRKGFMYSRNTNENPQECFNASKLLTSHGMGIQVPLNATEFNYLCPAIINQIDARSCLIHTSEKKAEIPPKTYSLQI
Construction
1-309 aa
Protein Purity
> 85% as determined by SDS-PAGE.
Molecular Weight36.2 kDa (Predicted)
EndotoxinNot tested.
FormulationLyophilized from PBS, 0.05% Brij-78, pH 7.4
Reconstitution
Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 162 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.

Dose Conversion

You can also refer to dose conversion for different animals. More

Sci Citations

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.