Shopping Cart
Remove All
Your shopping cart is currently empty
Synonyms: Zrt- and Irt-like protein 6, Zinc transporter ZIP6, Solute carrier family 39 member 6, SLC39A6


| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 5 µg | $315 | 20 days | 20 days | |
| 10 µg | $529 | 20 days | 20 days | |
| 20 µg | $892 | 20 days | 20 days | |
| 50 µg | $1,180 | 20 days | 20 days | |
| 100 µg | $1,470 | 20 days | 20 days |
| Bioactivity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
| Description | SLC39A6 Protein, Macaca fascicularis, Recombinant (His) is expressed in in vitro E. coli expression system. The accession number is XP_005586923.1. |
| Species | Cynomolgus monkey |
| Expression System | in vitro E. coli expression system |
| Tag | C-10xHis |
| Accession Number | XP_005586923.1 |
| Amino Acid | MARKLSVILILTFTLSVTNPLHELKSAAAFPQTTEKISPNWESGINVDLAITTRQYHLQQLFYRYGENNSLSVEGFRKLLQNIGIDKIKRIHIHHDHDHHSDHEHHSDHEHHSDHEHHSHRNHAASGKNKRKALCPEHDSDSSGKDPRNSQGKGAHRPEHANGRRNVKDSVSTSEVTSTVYNTVSEGTHFLETIETPKLFPKDVSSSTPPSVTEKSLVSRLAGRKTNESMSEPRKGFMYSRNTNENPQECFNASKLLTSHGMGIQVPLNATEFNYLCPAIINQIDARSCLIHTSEKKAEIPPKTYSLQI |
| Construction | 1-309 aa |
| Protein Purity | > 85% as determined by SDS-PAGE. |
| Endotoxin | Not tested. |
| Formulation | Lyophilized from PBS, 0.05% Brij-78, pH 7.4 |
| Reconstitution | Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
| Synonyms | Zrt- and Irt-like protein 6, Zinc transporter ZIP6, Solute carrier family 39 member 6, SLC39A6 |
| Molecular Weight | 36.2 kDa (Predicted) |
| Shipping | In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice. |
| Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 162 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.