Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

SLC30A8 Protein, Mouse, Recombinant (His)

TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-02979 Copy Product Info
Facilitates the accumulation of zinc from the cytoplasm into intracellular vesicles, being a zinc-efflux transporter. May be a major component for providing zinc to insulin maturation and/or storage processes in insulin-secreting pancreatic beta-cells. SLC30A8 Protein, Mouse, Recombinant (His) is expressed in E. coli expression system with N-10xHis tag. The predicted molecular weight is 43.0 kDa and the accession number is Q8BGG0.

SLC30A8 Protein, Mouse, Recombinant (His)

Catalog No. TMPH-02979
Copy Product Info
TargetMol | SPR Buffer-Exchangeable

Facilitates the accumulation of zinc from the cytoplasm into intracellular vesicles, being a zinc-efflux transporter. May be a major component for providing zinc to insulin maturation and/or storage processes in insulin-secreting pancreatic beta-cells. SLC30A8 Protein, Mouse, Recombinant (His) is expressed in E. coli expression system with N-10xHis tag. The predicted molecular weight is 43.0 kDa and the accession number is Q8BGG0.

SLC30A8 Protein, Mouse, Recombinant (His)
Pack SizePriceUSA StockGlobal StockQuantity
5 μg$52620 days20 days
10 μg$88620 days20 days
20 μg$1,50020 days20 days
50 μg$2,09020 days20 days
100 μg$2,75020 days20 days
Add to Cart
Add to Quotation
For In stock only · Estimated delivery:USA Stock (1-2 days) Global Stock (5-7 days)
For research use only—not for human use. No sales to individuals. Use as intended only.
Questions
View More

Batch Information

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
Facilitates the accumulation of zinc from the cytoplasm into intracellular vesicles, being a zinc-efflux transporter. May be a major component for providing zinc to insulin maturation and/or storage processes in insulin-secreting pancreatic beta-cells. SLC30A8 Protein, Mouse, Recombinant (His) is expressed in E. coli expression system with N-10xHis tag. The predicted molecular weight is 43.0 kDa and the accession number is Q8BGG0.
Species
Mouse
Expression System
E. coli
TagN-10xHis
Accession NumberQ8BGG0
Synonyms
Znt8,Zinc transporter 8 (ZnT-8),Solute carrier family 30 member 8,Slc30a8,Proton-coupled zinc antiporter SLC30A8
Amino Acid
MEFLERTYLVNDQATKMYAFPLDRELRQKPVNKDQCPGDRPEHPEAGGIYHCHNSAKATGNRSSKQAHAKWRLCAASAICFIFMVAEVVGGHVAGSLAILTDAAHLLIDLTSFLLSLFSLWLSSRPPSKRLTFGWYRAEILGALLSVLCIWVVTGVLLYLACERLLYPDYQIQAGIMITVSGCAVAANIVLTMILHQRNFGYNHKDVQANASVRAAFVHALGDVFQSISVLISALIIYFKPDYKIADPVCTFIFSILVLASTVMILKDFSILLMEGVPKGLSYNSVKEIILAVDGVISVHSLHIWSLTVNQVILSVHVATAASQDSQSVRTGIAQALSSFDLHSLTIQIESAADQDPSCLLCEDPQD
Construction
1-367 aa
Protein Purity
> 85% as determined by SDS-PAGE.
Molecular Weight43.0 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationIf the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Research Background
Facilitates the accumulation of zinc from the cytoplasm into intracellular vesicles, being a zinc-efflux transporter. May be a major component for providing zinc to insulin maturation and/or storage processes in insulin-secreting pancreatic beta-cells.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords