SLC1A3 Protein, Human, Recombinant (His)

Catalog No. TMPH-04809 Copy Product Info

SLC1A3 Protein, Human, Recombinant (His) is expressed in Yeast. The accession number is P43003.

SLC1A3 Protein, Human, Recombinant (His)

Catalog No. TMPH-04809

Copy Product Info

SLC1A3 Protein, Human, Recombinant (His) is expressed in Yeast. The accession number is P43003.

Pack Size	Price	USA Stock	Global Stock
5 μg	$144	-	In Stock
10 μg	$230	-	In Stock
20 μg	$368	20 days	20 days
50 μg	$553	20 days	20 days
100 μg	$694	20 days	20 days
1 mg	$2,960	20 days	20 days

Add to Cart

Add to Quotation

In stock · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Batch Information

Select Batch

Resource Download

COA User Guide of Recombinant Proteins

Product Information

Biological Activity	Activity has not been tested. It is theoretically active, but we cannot guarantee it.
Description	SLC1A3 Protein, Human, Recombinant (His) is expressed in Yeast. The accession number is P43003.
Species	Human
Expression System	Yeast
Tag	C-6xHis
Accession Number	P43003
Synonyms	SLC1A3,GLAST-1,GLAST1,GLAST,EAAT1
Amino Acid	HPGKGTKENMHREGKIVRVTAADAFLDLIRNMFPPNLVEACFKQFKTNYEKRSFKVPIQANETLVGAVINNVSEAMETLTRITEELVPVPG
Construction	146-236 aa
Protein Purity	> 90% as determined by SDS-PAGE.
Molecular Weight	11.7 kDa (Predicted); 25-55kDa (Reducing conditions due to glycosylation)
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4.
Reconstitution	Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage	It is recommended to store recombinant proteins at -20°C to -80°C for future use. Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.