Shopping Cart
Remove All
Your shopping cart is currently empty
SLC1A3 Protein, Human, Recombinant (His) is expressed in Yeast. The accession number is P43003.

| Pack Size | Price | USA Warehouse | Global Warehouse | Quantity |
|---|---|---|---|---|
| 5 μg | $144 | - | In Stock | |
| 10 μg | $230 | - | In Stock | |
| 20 μg | $368 | 20 days | 20 days | |
| 50 μg | $553 | 20 days | 20 days | |
| 100 μg | $694 | 20 days | 20 days | |
| 1 mg | $2,960 | 20 days | 20 days |
| Biological Activity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. |
| Description | SLC1A3 Protein, Human, Recombinant (His) is expressed in Yeast. The accession number is P43003. |
| Species | Human |
| Expression System | Yeast |
| Tag | C-6xHis |
| Accession Number | P43003 |
| Synonyms | SLC1A3,GLAST-1,GLAST1,GLAST,EAAT1 |
| Amino Acid | HPGKGTKENMHREGKIVRVTAADAFLDLIRNMFPPNLVEACFKQFKTNYEKRSFKVPIQANETLVGAVINNVSEAMETLTRITEELVPVPG |
| Construction | 146-236 aa |
| Protein Purity | > 90% as determined by SDS-PAGE. ![]() |
| Molecular Weight | 11.7 kDa (Predicted); 25-55kDa (Reducing conditions due to glycosylation) |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4. |
| Reconstitution | Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
| Stability & Storage | It is recommended to store recombinant proteins at -20°C to -80°C for future use. Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
| Shipping | In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice. |
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.