Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

SLC1A3 Protein, Human, Recombinant (His)

TargetMol | SPR
Catalog No. TMPH-04809 Copy Product Info
SLC1A3 Protein, Human, Recombinant (His) is expressed in Yeast. The accession number is P43003.

SLC1A3 Protein, Human, Recombinant (His)

Catalog No. TMPH-04809
Copy Product Info
TargetMol | SPR

SLC1A3 Protein, Human, Recombinant (His) is expressed in Yeast. The accession number is P43003.

SLC1A3 Protein, Human, Recombinant (His)
Pack SizePriceUSA StockGlobal StockQuantity
5 μg$144-In Stock
10 μg$230-In Stock
20 μg$36820 days20 days
50 μg$55320 days20 days
100 μg$69420 days20 days
1 mg$2,96020 days20 days
Add to Cart
Add to Quotation
For In stock only · Estimated delivery:USA Stock (1-2 days) Global Stock (5-7 days)
For research use only—not for human use. No sales to individuals. Use as intended only.
Questions
View More

Batch Information

Select Batch

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it.
Description
SLC1A3 Protein, Human, Recombinant (His) is expressed in Yeast. The accession number is P43003.
Species
Human
Expression System
Yeast
TagC-6xHis
Accession NumberP43003
Synonyms
SLC1A3,GLAST-1,GLAST1,GLAST,EAAT1
Amino Acid
HPGKGTKENMHREGKIVRVTAADAFLDLIRNMFPPNLVEACFKQFKTNYEKRSFKVPIQANETLVGAVINNVSEAMETLTRITEELVPVPG
Construction
146-236 aa
Protein Purity
> 90% as determined by SDS-PAGE.
SLC1A3 Protein, Human, Recombinant (His)
Molecular Weight11.7 kDa (Predicted); 25-55kDa (Reducing conditions due to glycosylation)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationLyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4.
Reconstitution
Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage
It is recommended to store recombinant proteins at -20°C to -80°C for future use. Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords