Shopping Cart
  • Remove All
  • TargetMol
    Your shopping cart is currently empty

SFTPB Protein, Human, Recombinant

Catalog No. TMPH-01979

Pulmonary surfactant-associated proteins promote alveolar stability by lowering the surface tension at the air-liquid interface in the peripheral air spaces. SP-B increases the collapse pressure of palmitic acid to nearly 70 millinewtons per meter. SFTPB Protein, Human, Recombinant is expressed in yeast. The predicted molecular weight is 8.7 kDa and the accession number is P07988.

SFTPB Protein, Human, Recombinant

SFTPB Protein, Human, Recombinant

Catalog No. TMPH-01979
Pulmonary surfactant-associated proteins promote alveolar stability by lowering the surface tension at the air-liquid interface in the peripheral air spaces. SP-B increases the collapse pressure of palmitic acid to nearly 70 millinewtons per meter. SFTPB Protein, Human, Recombinant is expressed in yeast. The predicted molecular weight is 8.7 kDa and the accession number is P07988.
Pack SizePriceAvailabilityQuantity
20 μg$43920 days
100 μg$76020 days
500 μg$1,80020 days
Bulk & Custom
Add to Cart
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.
Questions
View More

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
Pulmonary surfactant-associated proteins promote alveolar stability by lowering the surface tension at the air-liquid interface in the peripheral air spaces. SP-B increases the collapse pressure of palmitic acid to nearly 70 millinewtons per meter. SFTPB Protein, Human, Recombinant is expressed in yeast. The predicted molecular weight is 8.7 kDa and the accession number is P07988.
Species
Human
Expression System
P. pastoris (Yeast)
TagTag Free
Accession NumberP07988
Synonyms
SP-B,SFTPB,SFTP3,Pulmonary surfactant-associated proteolipid SPL(Phe),Pulmonary surfactant-associated protein B,6 kDa protein,18 kDa pulmonary-surfactant protein
Amino Acid
FPIPLPYCWLCRALIKRIQAMIPKGALAVAVAQVCRVVPLVAGGICQCLAERYSVILLDTLLGRMLPQLVCRLVLRCSM
Construction
201-279 aa
Protein Purity
> 90% as determined by SDS-PAGE.
Molecular Weight8.7 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationTris-based buffer, 50% glycerol
Reconstitution
A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.
Research Background
Pulmonary surfactant-associated proteins promote alveolar stability by lowering the surface tension at the air-liquid interface in the peripheral air spaces. SP-B increases the collapse pressure of palmitic acid to nearly 70 millinewtons per meter.

Dose Conversion

You can also refer to dose conversion for different animals. More

Sci Citations

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords