SFTPB Protein, Human, Recombinant

Catalog No. TMPH-01979 Copy Product Info

Pulmonary surfactant-associated proteins promote alveolar stability by lowering the surface tension at the air-liquid interface in the peripheral air spaces. SP-B increases the collapse pressure of palmitic acid to nearly 70 millinewtons per meter. SFTPB Protein, Human, Recombinant is expressed in yeast. The predicted molecular weight is 8.7 kDa and the accession number is P07988.

SFTPB Protein, Human, Recombinant

Catalog No. TMPH-01979

Copy Product Info

Pack Size	Price	USA Stock	Global Stock
5 μg	$158	20 days	20 days
10 μg	$262	20 days	20 days
20 μg	$439	20 days	20 days
50 μg	$588	20 days	20 days
100 μg	$760	20 days	20 days
200 μg	$1,080	20 days	20 days
500 μg	$1,800	20 days	20 days

Add to Cart

Add to Quotation

For In stock only · Estimated delivery:USA Stock (1-2 days) Global Stock (5-7 days)

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Batch Information

Resource Download

User Guide of Recombinant Proteins

Product Information

Biological Activity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	Pulmonary surfactant-associated proteins promote alveolar stability by lowering the surface tension at the air-liquid interface in the peripheral air spaces. SP-B increases the collapse pressure of palmitic acid to nearly 70 millinewtons per meter. SFTPB Protein, Human, Recombinant is expressed in yeast. The predicted molecular weight is 8.7 kDa and the accession number is P07988.
Species	Human
Expression System	P. pastoris (Yeast)
Tag	Tag Free
Accession Number	P07988
Synonyms	SP-B,SFTPB,SFTP3,Pulmonary surfactant-associated proteolipid SPL(Phe),Pulmonary surfactant-associated protein B,6 kDa protein,18 kDa pulmonary-surfactant protein
Amino Acid	FPIPLPYCWLCRALIKRIQAMIPKGALAVAVAQVCRVVPLVAGGICQCLAERYSVILLDTLLGRMLPQLVCRLVLRCSM
Construction	201-279 aa
Protein Purity	> 90% as determined by SDS-PAGE.
Molecular Weight	8.7 kDa (predicted)
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Tris-based buffer, 50% glycerol
Reconstitution	A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Research Background	Pulmonary surfactant-associated proteins promote alveolar stability by lowering the surface tension at the air-liquid interface in the peripheral air spaces. SP-B increases the collapse pressure of palmitic acid to nearly 70 millinewtons per meter.