Home Tools
Log in
Cart

SFTPB Protein, Human, Recombinant

Catalog No. TMPH-01979

Pulmonary surfactant-associated proteins promote alveolar stability by lowering the surface tension at the air-liquid interface in the peripheral air spaces. SP-B increases the collapse pressure of palmitic acid to nearly 70 millinewtons per meter. SFTPB Protein, Human, Recombinant is expressed in yeast. The predicted molecular weight is 8.7 kDa and the accession number is P07988.

All products from TargetMol are for Research Use Only. Not for Human or Veterinary or Therapeutic Use.
SFTPB Protein, Human, Recombinant
Pack Size Availability Price/USD Quantity
20 μg 20 days $ 439.00
100 μg 20 days $ 691.00
500 μg 20 days $ 1,640.00
Bulk Inquiry
Get quote
Contact us for more batch information
Biological Description
Technical Params
Product Properties
Description Pulmonary surfactant-associated proteins promote alveolar stability by lowering the surface tension at the air-liquid interface in the peripheral air spaces. SP-B increases the collapse pressure of palmitic acid to nearly 70 millinewtons per meter. SFTPB Protein, Human, Recombinant is expressed in yeast. The predicted molecular weight is 8.7 kDa and the accession number is P07988.
Species Human
Expression System P. pastoris (Yeast)
Tag Tag Free
Accession Number P07988
Amino Acid FPIPLPYCWLCRALIKRIQAMIPKGALAVAVAQVCRVVPLVAGGICQCLAERYSVILLDTLLGRMLPQLVCRLVLRCSM
Construction 201-279 aa
Protein Purity > 90% as determined by SDS-PAGE.
Molecular Weight 8.7 kDa (predicted)
Formulation Tris-based buffer, 50% glycerol
Reconstitution A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage

Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at-80℃. For reconstituted protein solutions, the solution can be stored at -20°c to -80'c for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.

Shipping

In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.

Research Background Pulmonary surfactant-associated proteins promote alveolar stability by lowering the surface tension at the air-liquid interface in the peripheral air spaces. SP-B increases the collapse pressure of palmitic acid to nearly 70 millinewtons per meter.

Calculator

Reconstitution Calculator
Recombinant Proteins Dilute Calculator
Specific Activity Calculator
=
÷
X
=
X
(Unit/mg)
= 106 ÷
ng/mL

bottom

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords

recombinant recombinant-proteins proteins protein

 

TargetMol