SCGB3A2 Protein, Mouse, Recombinant (GST & His)

Name: SCGB3A2 Protein, Mouse, Recombinant (GST & His)
Brand: TargetMol
SKU: TMPH-02891
Rating: 4.5 (1 reviews)

(Synonyms: Uteroglobin-related protein 1, Ugrp1, Secretoglobin family 3A member 2, Scgb3a2, Pnsp1, Pneumo secretory protein 1 (PnSP-1)) Copy Product Info

Synonyms: Uteroglobin-related protein 1, Ugrp1, Secretoglobin family 3A member 2, Scgb3a2, Pnsp1, Pneumo secretory protein 1 (PnSP-1)

Catalog No. TMPH-02891 Copy Product Info

SCGB3A2 Protein, Mouse, Recombinant (GST & His) is expressed in E. coli expression system with N-6xHis-GST tag. The predicted molecular weight is 43.2 kDa and the accession number is Q920H1.

Customer service consultation

Pack Size	Price	USA Stock	Global Stock
5 µg	$105	20 days	20 days
10 µg	$169	20 days	20 days
20 µg	$283	20 days	20 days
50 µg	$428	20 days	20 days
100 µg	$590	20 days	20 days
200 µg	$913	20 days	20 days
500 µg	$1,620	20 days	20 days
1 mg	$2,530	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Resource Download

User Guide of Recombinant Proteins

Product Introduction

Bioactivity

Bioactivity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	SCGB3A2 Protein, Mouse, Recombinant (GST & His) is expressed in E. coli expression system with N-6xHis-GST tag. The predicted molecular weight is 43.2 kDa and the accession number is Q920H1.
Species	Mouse
Expression System	E. coli
Tag	N-6xHis-GST
Accession Number	Q920H1
Amino Acid	LLINRLPVVDKLPVPLDDIIPSFDPLKMLLKTLGISVEHLVTGLKKCVDELGPEASEAVKKLLVIIICSYFPGRSLCYVNNLPSFVSVLFLPMICAYPRDSKKQTFAFIERVFEQSKL
Construction	22-139 aa
Protein Purity	> 90% as determined by SDS-PAGE.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Tris-based buffer, 50% glycerol
Reconstitution	A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Synonyms	Uteroglobin-related protein 1, Ugrp1, Secretoglobin family 3A member 2, Scgb3a2, Pnsp1, Pneumo secretory protein 1 (PnSP-1)
Research Background	Secreted cytokine-like protein. Binds to the scavenger receptor MARCO. Can also bind to pathogens including the Gram-positive bacterium L.monocytogenes, the Gram-negative bacterium P.aeruginosa, and yeast. Strongly inhibits phospholipase A2 (PLA2G1B) activity. Seems to have anti-inflammatory effects in respiratory epithelium. Also has anti-fibrotic activity in lung. May play a role in fetal lung development and maturation. Promotes branching morphogenesis during early stages of lung development. In the pituitary, may inhibit production of follicle-stimulating hormone (FSH) and luteinizing hormone (LH).

Chemical Properties

Molecular Weight

43.2 kDa (predicted)

Storage & Solubility Information

Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.