Shopping Cart
  • Remove All
  • TargetMol
    Your shopping cart is currently empty

SCGB3A2 Protein, Mouse, Recombinant (GST & His)

Catalog No. TMPH-02891

SCGB3A2 Protein, Mouse, Recombinant (GST & His) is expressed in E. coli expression system with N-6xHis-GST tag. The predicted molecular weight is 43.2 kDa and the accession number is Q920H1.

SCGB3A2 Protein, Mouse, Recombinant (GST & His)

SCGB3A2 Protein, Mouse, Recombinant (GST & His)

Catalog No. TMPH-02891
SCGB3A2 Protein, Mouse, Recombinant (GST & His) is expressed in E. coli expression system with N-6xHis-GST tag. The predicted molecular weight is 43.2 kDa and the accession number is Q920H1.
Pack SizePriceAvailabilityQuantity
20 μg $28420 days
100 μg $59020 days
1 mg $2,53020 days
Bulk & Custom
Add to Cart
Questions
View More
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
SCGB3A2 Protein, Mouse, Recombinant (GST & His) is expressed in E. coli expression system with N-6xHis-GST tag. The predicted molecular weight is 43.2 kDa and the accession number is Q920H1.
Species
Mouse
Expression System
E. coli
TagN-6xHis-GST
Accession NumberQ920H1
Synonyms
Uteroglobin-related protein 1,Ugrp1,Secretoglobin family 3A member 2,Scgb3a2,Pnsp1,Pneumo secretory protein 1 (PnSP-1)
Amino Acid
LLINRLPVVDKLPVPLDDIIPSFDPLKMLLKTLGISVEHLVTGLKKCVDELGPEASEAVKKLLVIIICSYFPGRSLCYVNNLPSFVSVLFLPMICAYPRDSKKQTFAFIERVFEQSKL
Construction
22-139 aa
Protein Purity
> 90% as determined by SDS-PAGE.
Molecular Weight43.2 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationTris-based buffer, 50% glycerol
Reconstitution
A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.
Research Background
Secreted cytokine-like protein. Binds to the scavenger receptor MARCO. Can also bind to pathogens including the Gram-positive bacterium L.monocytogenes, the Gram-negative bacterium P.aeruginosa, and yeast. Strongly inhibits phospholipase A2 (PLA2G1B) activity. Seems to have anti-inflammatory effects in respiratory epithelium. Also has anti-fibrotic activity in lung. May play a role in fetal lung development and maturation. Promotes branching morphogenesis during early stages of lung development. In the pituitary, may inhibit production of follicle-stimulating hormone (FSH) and luteinizing hormone (LH).

Dose Conversion

You can also refer to dose conversion for different animals. More

Sci Citations

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords