Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

Saxiphilin Protein, Aquarana catesbeiana, Recombinant (His)

TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-03483 Copy Product Info
Binds specifically to the neurotoxin saxitoxin. Its physiological role may be to transport or sequester an endogenous organic molecule other than Fe(3+). It may participate in a detoxification mechanism for neutralizing a microbial toxin. Saxiphilin Protein, Aquarana catesbeiana, Recombinant (His) is expressed in HEK293 mammalian cells with N-6xHis-Myc tag. The predicted molecular weight is 43.7 kDa and the accession number is P31226.

Saxiphilin Protein, Aquarana catesbeiana, Recombinant (His)

Catalog No. TMPH-03483
Copy Product Info
TargetMol | SPR Buffer-Exchangeable

Binds specifically to the neurotoxin saxitoxin. Its physiological role may be to transport or sequester an endogenous organic molecule other than Fe(3+). It may participate in a detoxification mechanism for neutralizing a microbial toxin. Saxiphilin Protein, Aquarana catesbeiana, Recombinant (His) is expressed in HEK293 mammalian cells with N-6xHis-Myc tag. The predicted molecular weight is 43.7 kDa and the accession number is P31226.

Saxiphilin Protein, Aquarana catesbeiana, Recombinant (His)
Pack SizePriceUSA StockGlobal StockQuantity
5 μg$16720 days20 days
10 μg$27820 days20 days
20 μg$46520 days20 days
50 μg$87820 days20 days
100 μg$1,43020 days20 days
200 μg$2,29020 days20 days
500 μg$4,30020 days20 days
Add to Cart
Add to Quotation
For In stock only · Estimated delivery:USA Stock (1-2 days) Global Stock (5-7 days)
For research use only—not for human use. No sales to individuals. Use as intended only.
Questions
View More

Batch Information

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
Binds specifically to the neurotoxin saxitoxin. Its physiological role may be to transport or sequester an endogenous organic molecule other than Fe(3+). It may participate in a detoxification mechanism for neutralizing a microbial toxin. Saxiphilin Protein, Aquarana catesbeiana, Recombinant (His) is expressed in HEK293 mammalian cells with N-6xHis-Myc tag. The predicted molecular weight is 43.7 kDa and the accession number is P31226.
Species
Lithobates catesbeiana
Expression System
HEK293 Cells
TagN-6xHis-Myc
Accession NumberP31226
Synonyms
Saxiphilin,SAX
Amino Acid
AHLPSKNKVRWCTINKLEKMKCDDWSAVSGGAIACTEASCPKGCVKQILKGEADAVKLEVQYMYEALMCGLLPAVEEYHNKDDFGPCKTPGSPYTDFGTLRAVALVKKSNKDINWNNIKGKKSCHTGVGDIAGWVIPVSLIRRQNDNSDIDSFFGESCAPGSDTKSNLCKLCIGDPKNSAANTKCSLSDKEAYYGNQGAFRCLVEKGDVAFVPHTVVFENTDGKNPAVWAKNLKSEDFELLCLDGSRAPVSNYKSCKLSGIPPPAIVTREESISDVVRIVANQQSLYGRKGFEKDMFQLFSSNKGNNLLFNDNTQCLITFDRQPKDIMEDYFGKPYYTTVYGASRSAMSSELISACTIKHC
Construction
484-844 aa
Protein Purity
> 90% as determined by SDS-PAGE.
Molecular Weight43.7 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationTris-based buffer, 50% glycerol
Reconstitution
A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Research Background
Binds specifically to the neurotoxin saxitoxin. Its physiological role may be to transport or sequester an endogenous organic molecule other than Fe(3+). It may participate in a detoxification mechanism for neutralizing a microbial toxin.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.