Shopping Cart
  • Remove All
  • TargetMol
    Your shopping cart is currently empty

Saxiphilin Protein, Aquarana catesbeiana, Recombinant (His)

TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-03483

Binds specifically to the neurotoxin saxitoxin. Its physiological role may be to transport or sequester an endogenous organic molecule other than Fe(3+). It may participate in a detoxification mechanism for neutralizing a microbial toxin. Saxiphilin Protein, Aquarana catesbeiana, Recombinant (His) is expressed in HEK293 mammalian cells with N-6xHis-Myc tag. The predicted molecular weight is 43.7 kDa and the accession number is P31226.

Saxiphilin Protein, Aquarana catesbeiana, Recombinant (His)

Saxiphilin Protein, Aquarana catesbeiana, Recombinant (His)

TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-03483
Binds specifically to the neurotoxin saxitoxin. Its physiological role may be to transport or sequester an endogenous organic molecule other than Fe(3+). It may participate in a detoxification mechanism for neutralizing a microbial toxin. Saxiphilin Protein, Aquarana catesbeiana, Recombinant (His) is expressed in HEK293 mammalian cells with N-6xHis-Myc tag. The predicted molecular weight is 43.7 kDa and the accession number is P31226.
Pack SizePriceAvailabilityQuantity
5 μg$16720 days
10 μg$27820 days
20 μg$46520 days
50 μg$87820 days
100 μg$1,43020 days
200 μg$2,29020 days
500 μg$4,30020 days
Bulk & Custom
Add to Cart
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.
Questions
View More

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
Binds specifically to the neurotoxin saxitoxin. Its physiological role may be to transport or sequester an endogenous organic molecule other than Fe(3+). It may participate in a detoxification mechanism for neutralizing a microbial toxin. Saxiphilin Protein, Aquarana catesbeiana, Recombinant (His) is expressed in HEK293 mammalian cells with N-6xHis-Myc tag. The predicted molecular weight is 43.7 kDa and the accession number is P31226.
Species
Lithobates catesbeiana
Expression System
HEK293 Cells
TagN-6xHis-Myc
Accession NumberP31226
Synonyms
Saxiphilin,SAX
Amino Acid
AHLPSKNKVRWCTINKLEKMKCDDWSAVSGGAIACTEASCPKGCVKQILKGEADAVKLEVQYMYEALMCGLLPAVEEYHNKDDFGPCKTPGSPYTDFGTLRAVALVKKSNKDINWNNIKGKKSCHTGVGDIAGWVIPVSLIRRQNDNSDIDSFFGESCAPGSDTKSNLCKLCIGDPKNSAANTKCSLSDKEAYYGNQGAFRCLVEKGDVAFVPHTVVFENTDGKNPAVWAKNLKSEDFELLCLDGSRAPVSNYKSCKLSGIPPPAIVTREESISDVVRIVANQQSLYGRKGFEKDMFQLFSSNKGNNLLFNDNTQCLITFDRQPKDIMEDYFGKPYYTTVYGASRSAMSSELISACTIKHC
Construction
484-844 aa
Protein Purity
> 90% as determined by SDS-PAGE.
Molecular Weight43.7 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationTris-based buffer, 50% glycerol
Reconstitution
A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.
Research Background
Binds specifically to the neurotoxin saxitoxin. Its physiological role may be to transport or sequester an endogenous organic molecule other than Fe(3+). It may participate in a detoxification mechanism for neutralizing a microbial toxin.

Dose Conversion

You can also refer to dose conversion for different animals. More

Sci Citations

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.