Shopping Cart
Remove All
Your shopping cart is currently empty
Binds specifically to the neurotoxin saxitoxin. Its physiological role may be to transport or sequester an endogenous organic molecule other than Fe(3+). It may participate in a detoxification mechanism for neutralizing a microbial toxin. Saxiphilin Protein, Aquarana catesbeiana, Recombinant (His) is expressed in HEK293 mammalian cells with N-6xHis-Myc tag. The predicted molecular weight is 43.7 kDa and the accession number is P31226.

| Pack Size | Price | USA Warehouse | Global Warehouse | Quantity |
|---|---|---|---|---|
| 5 μg | $167 | 20 days | 20 days | |
| 10 μg | $278 | 20 days | 20 days | |
| 20 μg | $465 | 20 days | 20 days | |
| 50 μg | $878 | 20 days | 20 days | |
| 100 μg | $1,430 | 20 days | 20 days | |
| 200 μg | $2,290 | 20 days | 20 days | |
| 500 μg | $4,300 | 20 days | 20 days |
| Biological Activity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
| Description | Binds specifically to the neurotoxin saxitoxin. Its physiological role may be to transport or sequester an endogenous organic molecule other than Fe(3+). It may participate in a detoxification mechanism for neutralizing a microbial toxin. Saxiphilin Protein, Aquarana catesbeiana, Recombinant (His) is expressed in HEK293 mammalian cells with N-6xHis-Myc tag. The predicted molecular weight is 43.7 kDa and the accession number is P31226. |
| Species | Lithobates catesbeiana |
| Expression System | HEK293 Cells |
| Tag | N-6xHis-Myc |
| Accession Number | P31226 |
| Synonyms | Saxiphilin,SAX |
| Amino Acid | AHLPSKNKVRWCTINKLEKMKCDDWSAVSGGAIACTEASCPKGCVKQILKGEADAVKLEVQYMYEALMCGLLPAVEEYHNKDDFGPCKTPGSPYTDFGTLRAVALVKKSNKDINWNNIKGKKSCHTGVGDIAGWVIPVSLIRRQNDNSDIDSFFGESCAPGSDTKSNLCKLCIGDPKNSAANTKCSLSDKEAYYGNQGAFRCLVEKGDVAFVPHTVVFENTDGKNPAVWAKNLKSEDFELLCLDGSRAPVSNYKSCKLSGIPPPAIVTREESISDVVRIVANQQSLYGRKGFEKDMFQLFSSNKGNNLLFNDNTQCLITFDRQPKDIMEDYFGKPYYTTVYGASRSAMSSELISACTIKHC |
| Construction | 484-844 aa |
| Protein Purity | > 90% as determined by SDS-PAGE. |
| Molecular Weight | 43.7 kDa (predicted) |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | Tris-based buffer, 50% glycerol |
| Reconstitution | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
| Shipping | In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice. |
| Research Background | Binds specifically to the neurotoxin saxitoxin. Its physiological role may be to transport or sequester an endogenous organic molecule other than Fe(3+). It may participate in a detoxification mechanism for neutralizing a microbial toxin. |
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.