Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

SAT1 Protein, Human, Recombinant (His)

TargetMol | SPR
Catalog No. TMPH-04665

SAT1 Protein, Human, Recombinant (His) is expressed in E. coli. The accession number is P21673.

SAT1 Protein, Human, Recombinant (His)

SAT1 Protein, Human, Recombinant (His)

TargetMol | SPR
Catalog No. TMPH-04665
SAT1 Protein, Human, Recombinant (His) is expressed in E. coli. The accession number is P21673.
Pack SizePriceUSA WarehouseGlobal WarehouseQuantity
5 μg$8720 days20 days
10 μg$13920 days20 days
20 μg$23220 days20 days
50 μg$32920 days20 days
100 μg$43520 days20 days
200 μg$67320 days20 days
500 μg$1,18020 days20 days
1 mg$1,87020 days20 days
Add to Cart
Add to Quotation
In Stock Estimated shipping dateUSA Warehouse [1-2 days] Global Warehouse [5-7 days]
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.
Questions
View More

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
SAT1 Protein, Human, Recombinant (His) is expressed in E. coli. The accession number is P21673.
Species
Human
Expression System
E. coli
TagC-6xHis
Accession NumberP21673
Synonyms
Spermidine/spermine N(1)-acetyltransferase 1 (SSAT;SSAT-1),SAT1,SAT,Putrescine acetyltransferase,Polyamine N-acetyltransferase 1,Diamine acetyltransferase 1
Amino Acid
VIRPATAADCSDILRLIKELAKYEYMEEQVILTEKDLLEDGFGEHPFYHCLVAEVPKEHWTPEGHSIVGFAMYYFTYDPWIGKLLYLEDFFVMSDYRGFGIGSEILKNLSQVAMRCRCSSMHFLVAEWNEPSINFYKRRGASDLSSEEGWRLFKIDKEYLLKMATEE
Construction
5-171 aa
Protein Purity
> 90% as determined by SDS-PAGE.
Molecular Weight26.5 kDa (Predicted)
EndotoxinNot tested.
FormulationLyophilized from PBS, 6% Trehalose, pH 7.4
Reconstitution
Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 302 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords