Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

SAM22 Protein, Glycine max, Recombinant (His)

TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-00774 Copy Product Info
Involved in disease resistance. SAM22 Protein, Glycine max, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 18.8 kDa and the accession number is P26987.

SAM22 Protein, Glycine max, Recombinant (His)

Catalog No. TMPH-00774
Copy Product Info
TargetMol | SPR Buffer-Exchangeable

Involved in disease resistance. SAM22 Protein, Glycine max, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 18.8 kDa and the accession number is P26987.

SAM22 Protein, Glycine max, Recombinant (His)
Pack SizePriceUSA StockGlobal StockQuantity
5 μg$14320 days20 days
10 μg$23820 days20 days
20 μg$39720 days20 days
50 μg$59720 days20 days
100 μg$84520 days20 days
200 μg$1,19020 days20 days
500 μg$1,95020 days20 days
Add to Cart
Add to Quotation
In stock · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)
For research use only—not for human use. No sales to individuals. Use as intended only.
Questions
View More

Batch Information

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
Involved in disease resistance. SAM22 Protein, Glycine max, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 18.8 kDa and the accession number is P26987.
Species
Glycine max
Expression System
P. pastoris (Yeast)
TagN-6xHis
Accession NumberP26987
Synonyms
Stress-induced protein SAM22,Starvation-associated message 22,PR-10,Pathogenesis-related protein 10
Amino Acid
MGVFTFEDEINSPVAPATLYKALVTDADNVIPKALDSFKSVENVEGNGGPGTIKKITFLEDGETKFVLHKIESIDEANLGYSYSVVGGAALPDTAEKITFDSKLVAGPNGGSAGKLTVKYETKGDAEPNQDELKTGKAKADALFKAIEAYLLAHPDYN
Construction
1-158 aa
Protein Purity
> 90% as determined by SDS-PAGE.
Molecular Weight18.8 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationTris-based buffer, 50% glycerol
Reconstitution
A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Research Background
Involved in disease resistance.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords