Shopping Cart
- Remove All
 
Your shopping cart is currently empty
Major acute phase reactant. Apolipoprotein of the HDL complex. SAA1 Protein, Feline, Recombinant (B2M & His) is expressed in E. coli expression system with N-6xHis-B2M tag. The predicted molecular weight is 24.1 kDa and the accession number is P19707.

| Pack Size | Price | Availability | Quantity | 
|---|---|---|---|
| 5 μg | $129 | 20 days | |
| 10 μg | $216 | 20 days | |
| 20 μg | $360 | 20 days | |
| 50 μg | $543 | 20 days | |
| 100 μg | $745 | 20 days | |
| 200 μg | $1,070 | 20 days | |
| 500 μg | $1,730 | 20 days | |
| 1 mg | $2,530 | 20 days | 
| Biological Activity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.  | 
| Description | Major acute phase reactant. Apolipoprotein of the HDL complex. SAA1 Protein, Feline, Recombinant (B2M & His) is expressed in E. coli expression system with N-6xHis-B2M tag. The predicted molecular weight is 24.1 kDa and the accession number is P19707.  | 
| Species | Feline  | 
| Expression System | E. coli  | 
| Tag | N-6xHis-B2M | 
| Accession Number | P19707 | 
| Synonyms | Serum amyloid A protein,SAA1,SAA  | 
| Amino Acid | EWYSFLGEAAQGAWDMWRAYSDMREANYIGADKYFHARGNYDAAQRGPGGAWAAKVISDARENSQRVTDFFRHGNSGHGAEDSKADQEWG  | 
| Construction | 1-90 aa  | 
| Protein Purity | > 90% as determined by SDS-PAGE.  | 
| Molecular Weight | 24.1 kDa (predicted) | 
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. | 
| Formulation | Tris-based buffer, 50% glycerol | 
| Reconstitution | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.  | 
| Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.  | 
| Shipping | In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice. | 
| Research Background | Major acute phase reactant. Apolipoprotein of the HDL complex.  | 

Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.