RVFV (strain ZH-548 M12) Nucleoprotein/NP Protein (His)

Name: RVFV (strain ZH-548 M12) Nucleoprotein/NP Protein (His)
Brand: TargetMol
SKU: TMPH-04816
Rating: 4.5 (1 reviews)

(Synonyms: Nucleoprotein, Nucleocapsid protein (Protein N)) Copy Product Info

Synonyms: Nucleoprotein, Nucleocapsid protein (Protein N)

Catalog No. TMPH-04816 Copy Product Info

RVFV (strain ZH-548 M12) Nucleoprotein/NP Protein (His) is expressed in Yeast. The accesssion number is P21700.

RVFV
(strain ZH-548 M12) Nucleoprotein/NP Protein
(His)

Customer service consultation

Pack Size	Price	USA Stock	Global Stock
5 µg	$158	20 days	20 days
10 µg	$253	20 days	20 days
20 µg	$405	20 days	20 days
100 µg	$845	20 days	20 days
1 mg	Inquiry	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Resource Download

Bioactivity

Bioactivity	Activity has not been tested. It is theoretically active, but we cannot guarantee it.
Description	RVFV (strain ZH-548 M12) Nucleoprotein/NP Protein (His) is expressed in Yeast. The accesssion number is P21700.
Species	RVFV
Expression System	P. pastoris (Yeast)
Tag	C-6xHis
Accession Number	P21700
Amino Acid	MDNYQELRVQFAAQAVDRNEIEQWVREFAYQGFDARRVIELLKQYGGADWEKDAKKMIVLALTRGNKPRRMMMKMSKEGKATVEALINKYKLKEGNPSRDELTLSRVAAALAGWTCQALVVLSEWLPVTGTTMDGLSPAYPRHMMHPSFAGMVDPSLPGDYLRAILDAHSLYLLQFSRVINPNLRGRTKEEVAATFTQPMNAAVNSNFISHEKRREFLKAFGLVDSNGKPSAAVMAAAQAYKTAA
Construction	1-245 aa
Protein Purity	> 85% as determined by SDS-PAGE.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Tris/PBS-based buffer
Reconstitution	Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Synonyms	Nucleoprotein, Nucleocapsid protein (Protein N)

Storage & Solubility Information

Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Storage	It is recommended to store recombinant proteins at -20°C to -80°C for future use. Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.