Shopping Cart
Remove All
Your shopping cart is currently empty
RVFV (strain ZH-548 M12) Nucleoprotein/NP Protein (His) is expressed in Yeast. The accesssion number is P21700.
| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 5 μg | $158 | 20 days | 20 days | |
| 10 μg | $253 | 20 days | 20 days | |
| 20 μg | $405 | 20 days | 20 days | |
| 100 μg | $845 | 20 days | 20 days | |
| 1 mg | Inquiry | 20 days | 20 days |
| Biological Activity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. |
| Description | RVFV (strain ZH-548 M12) Nucleoprotein/NP Protein (His) is expressed in Yeast. The accesssion number is P21700. |
| Species | RVFV |
| Expression System | P. pastoris (Yeast) |
| Tag | C-6xHis |
| Accession Number | P21700 |
| Synonyms | Nucleoprotein,Nucleocapsid protein (Protein N) |
| Amino Acid | MDNYQELRVQFAAQAVDRNEIEQWVREFAYQGFDARRVIELLKQYGGADWEKDAKKMIVLALTRGNKPRRMMMKMSKEGKATVEALINKYKLKEGNPSRDELTLSRVAAALAGWTCQALVVLSEWLPVTGTTMDGLSPAYPRHMMHPSFAGMVDPSLPGDYLRAILDAHSLYLLQFSRVINPNLRGRTKEEVAATFTQPMNAAVNSNFISHEKRREFLKAFGLVDSNGKPSAAVMAAAQAYKTAA |
| Construction | 1-245 aa |
| Protein Purity | > 85% as determined by SDS-PAGE. |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | Tris/PBS-based buffer |
| Reconstitution | Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
| Stability & Storage | It is recommended to store recombinant proteins at -20°C to -80°C for future use. Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
| Shipping | In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice. |
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.