Shopping Cart
- Remove All
Your shopping cart is currently empty
Rubredoxin is a small nonheme, iron protein lacking acid-labile sulfide. Its single Fe, chelated to 4 Cys, functions as an electron acceptor and may also stabilize the conformation of the molecule. Rubredoxin Protein, Clostridium pasteurianum, Recombinant (His & SUMO) is expressed in E. coli expression system with N-6xHis-SUMO tag. The predicted molecular weight is 22.0 kDa and the accession number is P00268.

| Pack Size | Price | Availability | Quantity |
|---|---|---|---|
| 5 μg | $129 | In Stock | |
| 10 μg | $216 | In Stock | |
| 20 μg | $360 | 20 days | |
| 50 μg | $543 | 20 days | |
| 100 μg | $745 | 20 days | |
| 200 μg | $1,070 | 20 days | |
| 500 μg | $1,730 | 20 days | |
| 1 mg | $2,530 | 20 days |
| Biological Activity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
| Description | Rubredoxin is a small nonheme, iron protein lacking acid-labile sulfide. Its single Fe, chelated to 4 Cys, functions as an electron acceptor and may also stabilize the conformation of the molecule. Rubredoxin Protein, Clostridium pasteurianum, Recombinant (His & SUMO) is expressed in E. coli expression system with N-6xHis-SUMO tag. The predicted molecular weight is 22.0 kDa and the accession number is P00268. |
| Species | Clostridium pasteurianum |
| Expression System | E. coli |
| Tag | N-6xHis-SUMO |
| Accession Number | P00268 |
| Synonyms | Rubredoxin,Rd |
| Amino Acid | MKKYTCTVCGYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLCGVGKDQFEEVEE |
| Construction | 1-54 aa |
| Protein Purity | > 90% as determined by SDS-PAGE. |
| Molecular Weight | 22.0 kDa (predicted) |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | Tris-based buffer, 50% glycerol |
| Reconstitution | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
| Shipping | In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice. |
| Research Background | Rubredoxin is a small nonheme, iron protein lacking acid-labile sulfide. Its single Fe, chelated to 4 Cys, functions as an electron acceptor and may also stabilize the conformation of the molecule. |

Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.