Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

RPB1 Protein, Drosophila melanogaster, Recombinant (His)

TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-00505 Copy Product Info
RPB1 Protein, Drosophila melanogaster, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 33.6 kDa and the accession number is P04052.

RPB1 Protein, Drosophila melanogaster, Recombinant (His)

Catalog No. TMPH-00505
Copy Product Info
TargetMol | SPR Buffer-Exchangeable

RPB1 Protein, Drosophila melanogaster, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 33.6 kDa and the accession number is P04052.

RPB1 Protein, Drosophila melanogaster, Recombinant (His)
Pack SizePriceUSA StockGlobal StockQuantity
5 μg$14320 days20 days
10 μg$23820 days20 days
20 μg$39720 days20 days
50 μg$59720 days20 days
100 μg$84520 days20 days
200 μg$1,19020 days20 days
500 μg$1,95020 days20 days
Add to Cart
Add to Quotation
For In stock only · Estimated delivery:USA Stock (1-2 days) Global Stock (5-7 days)
For research use only—not for human use. No sales to individuals. Use as intended only.
Questions
View More

Batch Information

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
RPB1 Protein, Drosophila melanogaster, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 33.6 kDa and the accession number is P04052.
Species
Fruit fly
Expression System
P. pastoris (Yeast)
TagN-6xHis
Accession NumberP04052
Synonyms
RpII215,RPB1,RNA polymerase II subunit B1,RNA polymerase II subunit A,Polr2A,DNA-directed RNA polymerase III largest subunit,DNA-directed RNA polymerase II subunit RPB1
Amino Acid
YSPTSPNYTASSPGGASPNYSPSSPNYSPTSPLYASPRYASTTPNFNPQSTGYSPSSSGYSPTSPVYSPTVQFQSSPSFAGSGSNIYSPGNAYSPSSSNYSPNSPSYSPTSPSYSPSSPSYSPTSPCYSPTSPSYSPTSPNYTPVTPSYSPTSPNYSASPQYSPASPAYSQTGVKYSPTSPTYSPPSPSYDGSPGSPQYTPGSPQYSPASPKYSPTSPLYSPSSPQHSPSNQYSPTGSTYSATSPRYSPNMSIYSPSSTKYSPTSPTYTPTARNYSPTSPMYSPTAPSHYSPTSPAYSPSSPT
Construction
1579-1881 aa
Protein Purity
> 90% as determined by SDS-PAGE.
Molecular Weight33.6 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationTris-based buffer, 50% glycerol
Reconstitution
A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Research Background
DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Largest and catalytic component of RNA polymerase II which synthesizes mRNA precursors and many functional non-coding RNAs. Forms the polymerase active center together with the second largest subunit. Pol II is the central component of the basal RNA polymerase II transcription machinery. It is composed of mobile elements that move relative to each other. RPB1 is part of the core element with the central large cleft, the clamp element that moves to open and close the cleft and the jaws that are thought to grab the incoming DNA template. At the start of transcription, a single-stranded DNA template strand of the promoter is positioned within the central active site cleft of Pol II. A bridging helix emanates from RPB1 and crosses the cleft near the catalytic site and is thought to promote translocation of Pol II by acting as a ratchet that moves the RNA-DNA hybrid through the active site by switching from straight to bent conformations at each step of nucleotide addition. During transcription elongation, Pol II moves on the template as the transcript elongates. Elongation is influenced by the phosphorylation status of the C-terminal domain (CTD) of Pol II largest subunit (RPB1), which serves as a platform for assembly of factors that regulate transcription initiation, elongation, termination and mRNA processing.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords