Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

RNF182 Protein, Human, Recombinant (His)

TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-03901 Copy Product Info
RNF182 Protein, Human, Recombinant (His) is expressed in P. pastoris (Yeast) with C-6xHis. The accession number is Q8N6D2.

RNF182 Protein, Human, Recombinant (His)

Catalog No. TMPH-03901
Copy Product Info
TargetMol | SPR Buffer-Exchangeable

RNF182 Protein, Human, Recombinant (His) is expressed in P. pastoris (Yeast) with C-6xHis. The accession number is Q8N6D2.

RNF182 Protein, Human, Recombinant (His)
Pack SizePriceUSA StockGlobal StockQuantity
5 μg$12320 days20 days
10 μg$19820 days20 days
20 μg$33820 days20 days
50 μg$48820 days20 days
100 μg$64620 days20 days
200 μg$99820 days20 days
500 μg$1,78020 days20 days
1 mg$2,76020 days20 days
Add to Cart
Add to Quotation
For In stock only · Estimated delivery:USA Stock (1-2 days) Global Stock (5-7 days)
For research use only—not for human use. No sales to individuals. Use as intended only.
Questions
View More

Batch Information

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it.
Description
RNF182 Protein, Human, Recombinant (His) is expressed in P. pastoris (Yeast) with C-6xHis. The accession number is Q8N6D2.
Species
Human
Expression System
P. pastoris (Yeast)
TagC-6xHis
Accession NumberQ8N6D2
Synonyms
RNF182,RING-type E3 ubiquitin transferase RNF182,RING finger protein 182,E3 ubiquitin-protein ligase RNF182
Amino Acid
MASQPPEDTAESQASDELECKICYNRYNLKQRKPKVLECCHRVCAKCLYKIIDFGDSPQGVIVCPFCRFETCLPDDEVSSLPDDNNILVNLTCGGKGKKCLPENPTELLLTPKRLASLVSPSHTSSNCLVITIMEVQRESSPSLSSTPVVEFYRPASFDSVTTVSHNWTVWNCTSLLFQTSIR
Construction
1-183 aa
Protein Purity
>85% as determined by SDS-PAGE.
Molecular Weight22.2 kDa (Predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationIf the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords