Home Tools
Log in
Cart

RNF13 Protein, Human, Recombinant (His)

Catalog No. TMPH-01266

RNF13 Protein, Human, Recombinant (His) is expressed in E. coli with N-terminal 10xHis tag. The predicted molecular weight is 26.2 kDa. Accession number: O43567

All products from TargetMol are for Research Use Only. Not for Human or Veterinary or Therapeutic Use.
RNF13 Protein, Human, Recombinant (His)
Pack Size Availability Price/USD Quantity
20 μg 20 days $ 284.00
100 μg 20 days $ 537.00
1 mg 20 days $ 2,300.00
Bulk Inquiry
Get quote
Contact us for more batch information
Technical Params
Product Properties
Description RNF13 Protein, Human, Recombinant (His) is expressed in E. coli with N-terminal 10xHis tag. The predicted molecular weight is 26.2 kDa. Accession number: O43567
Species Human
Expression System E. coli
Tag N-terminal 10xHis-tagged
Accession Number O43567
Amino Acid TKFVQDRHRARRNRLRKDQLKKLPVHKFKKGDEYDVCAICLDEYEDGDKLRILPCSHAYHCKCVDPWLTKTKKTCPVCKQKVVPSQGDSDSDTDSSQEENEVTEHTPLLRPLASVSAQSFGALSESRSHQNMTESSDYEEDDNEDTDSSDAENEINEHDVVVQLQPNGERDYNIANTV
Construction 204-381 aa
Protein Purity > 85% as determined by SDS-PAGE.
Molecular Weight 26.2 kDa (predicted)
Formulation Lyophilized from 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
Reconstitution A hardcopy of COA with reconstitution instructions is sent along with the products. Please refer to it for detailed information.
Stability & Storage

Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Shipping

In general, recombinant proteins are provided as lyophilized powder which are shipped at ambient temperature. Bulk packages of recombinant proteins are provided as frozen liquid. They are shipped out with blue ice unless customers require otherwise.

Calculator

Reconstitution Calculator
Recombinant Proteins Dilute Calculator
Specific Activity Calculator
=
÷
X
=
X
(Unit/mg)
= 106 ÷
ng/mL

bottom

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords

recombinant recombinant-proteins proteins protein

 

TargetMol