RNF13 Protein, Human, Recombinant (His) is expressed in E. coli with N-terminal 10xHis tag. The predicted molecular weight is 26.2 kDa. Accession number: O43567
Pack Size | Availability | Price/USD | Quantity |
---|---|---|---|
20 μg | 20 days | $ 284.00 | |
100 μg | 20 days | $ 537.00 | |
1 mg | 20 days | $ 2,300.00 |
Description | RNF13 Protein, Human, Recombinant (His) is expressed in E. coli with N-terminal 10xHis tag. The predicted molecular weight is 26.2 kDa. Accession number: O43567 |
Species | Human |
Expression System | E. coli |
Tag | N-terminal 10xHis-tagged |
Accession Number | O43567 |
Amino Acid | TKFVQDRHRARRNRLRKDQLKKLPVHKFKKGDEYDVCAICLDEYEDGDKLRILPCSHAYHCKCVDPWLTKTKKTCPVCKQKVVPSQGDSDSDTDSSQEENEVTEHTPLLRPLASVSAQSFGALSESRSHQNMTESSDYEEDDNEDTDSSDAENEINEHDVVVQLQPNGERDYNIANTV |
Construction | 204-381 aa |
Protein Purity | > 85% as determined by SDS-PAGE. |
Molecular Weight | 26.2 kDa (predicted) |
Formulation | Lyophilized from 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0 |
Reconstitution | A hardcopy of COA with reconstitution instructions is sent along with the products. Please refer to it for detailed information. |
Stability & Storage |
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
Shipping |
In general, recombinant proteins are provided as lyophilized powder which are shipped at ambient temperature. Bulk packages of recombinant proteins are provided as frozen liquid. They are shipped out with blue ice unless customers require otherwise. |
bottom
Please read the User Guide of Recombinant Proteins for more specific information.
recombinant recombinant-proteins proteins protein