RNF13 Protein, Human, Recombinant (His)

Catalog No. TMPH-01266 Copy Product Info

RNF13 Protein, Human, Recombinant (His) is expressed in E. coli with N-terminal 10xHis tag. The predicted molecular weight is 26.2 kDa. Accession number: O43567

RNF13 Protein, Human, Recombinant (His)

Catalog No. TMPH-01266

Copy Product Info

RNF13 Protein, Human, Recombinant (His) is expressed in E. coli with N-terminal 10xHis tag. The predicted molecular weight is 26.2 kDa. Accession number: O43567

Pack Size	Price	USA Stock	Global Stock
5 μg	$105	20 days	20 days
10 μg	$169	20 days	20 days
20 μg	$283	20 days	20 days
50 μg	$428	20 days	20 days
100 μg	$590	20 days	20 days
200 μg	$913	20 days	20 days
500 μg	$1,620	20 days	20 days
1 mg	$2,530	20 days	20 days

Add to Cart

Add to Quotation

In stock · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Batch Information

Resource Download

User Guide of Recombinant Proteins

Product Information

Biological Activity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	RNF13 Protein, Human, Recombinant (His) is expressed in E. coli with N-terminal 10xHis tag. The predicted molecular weight is 26.2 kDa. Accession number: O43567
Species	Human
Expression System	E. coli
Tag	N-10xHis
Accession Number	O43567
Synonyms	RZF,RNF13,RING finger protein 13,E3 ubiquitin-protein ligase RNF13
Amino Acid	TKFVQDRHRARRNRLRKDQLKKLPVHKFKKGDEYDVCAICLDEYEDGDKLRILPCSHAYHCKCVDPWLTKTKKTCPVCKQKVVPSQGDSDSDTDSSQEENEVTEHTPLLRPLASVSAQSFGALSESRSHQNMTESSDYEEDDNEDTDSSDAENEINEHDVVVQLQPNGERDYNIANTV
Construction	204-381 aa
Protein Purity	> 85% as determined by SDS-PAGE.
Molecular Weight	26.2 kDa (predicted)
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Lyophilized from 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
Reconstitution	A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.