Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

Rhesus cytomegalovirus (RhCMV) (strain 68-1) Glycoprotein B/gB Protein (His & Myc)

TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-03406 Copy Product Info
Rhesus cytomegalovirus (RhCMV) (strain 68-1) Glycoprotein B/gB Protein (His & Myc) is expressed in E. coli expression system with N-10xHis and C-Myc tag. The predicted molecular weight is 18.0 kDa and the accession number is P89053.

Rhesus cytomegalovirus (RhCMV) (strain 68-1) Glycoprotein B/gB Protein (His & Myc)

Catalog No. TMPH-03406
Copy Product Info
TargetMol | SPR Buffer-Exchangeable

Rhesus cytomegalovirus (RhCMV) (strain 68-1) Glycoprotein B/gB Protein (His & Myc) is expressed in E. coli expression system with N-10xHis and C-Myc tag. The predicted molecular weight is 18.0 kDa and the accession number is P89053.

Rhesus cytomegalovirus (RhCMV) (strain 68-1) Glycoprotein B/gB Protein (His & Myc)
Pack SizePriceUSA StockGlobal StockQuantity
5 μg$10520 days20 days
10 μg$16920 days20 days
20 μg$28320 days20 days
50 μg$42820 days20 days
100 μg$59020 days20 days
200 μg$91320 days20 days
500 μg$1,62020 days20 days
1 mg$2,53020 days20 days
Add to Cart
Add to Quotation
For In stock only · Estimated delivery:USA Stock (1-2 days) Global Stock (5-7 days)
For research use only—not for human use. No sales to individuals. Use as intended only.
Questions
View More

Batch Information

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
Rhesus cytomegalovirus (RhCMV) (strain 68-1) Glycoprotein B/gB Protein (His & Myc) is expressed in E. coli expression system with N-10xHis and C-Myc tag. The predicted molecular weight is 18.0 kDa and the accession number is P89053.
Species
RhCMV
Expression System
E. coli
TagN-10xHis, C-Myc
Accession NumberP89053
Synonyms
gB,Envelope glycoprotein B
Amino Acid
MRQKRAYEKPFEHFFPYVVPPTTVKEAPPSYEQSQYENIKEKAASATKEFSLEEAYQMLLALQKLDQEKRRKAEADDEDFASNGQSAGFLDRLRNRRRGGYQKIQNEYEV
Construction
745-854 aa
Protein Purity
> 85% as determined by SDS-PAGE.
Molecular Weight18.0 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationTris-based buffer, 50% glycerol
Reconstitution
A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Research Background
Envelope glycoprotein that forms spikes at the surface of virion envelope. Essential for the initial attachment to heparan sulfate moieties of the host cell surface proteoglycans. Involved in fusion of viral and cellular membranes leading to virus entry into the host cell. Following initial binding to its host receptors, membrane fusion is mediated by the fusion machinery composed at least of gB and the heterodimer gH/gL. May be involved in the fusion between the virion envelope and the outer nuclear membrane during virion egress.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.