Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

RHD Protein, Human, Recombinant (GST & His)

TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-01009 Copy Product Info
May be part of an oligomeric complex which is likely to have a transport or channel function in the erythrocyte membrane. RHD Protein, Human, Recombinant (GST & His) is expressed in E. coli expression system with N-6xHis-GST tag. The predicted molecular weight is 33.6 kDa and the accession number is Q02161.

RHD Protein, Human, Recombinant (GST & His)

Catalog No. TMPH-01009
Copy Product Info
TargetMol | SPR Buffer-Exchangeable

May be part of an oligomeric complex which is likely to have a transport or channel function in the erythrocyte membrane. RHD Protein, Human, Recombinant (GST & His) is expressed in E. coli expression system with N-6xHis-GST tag. The predicted molecular weight is 33.6 kDa and the accession number is Q02161.

RHD Protein, Human, Recombinant (GST & His)
Pack SizePriceUSA StockGlobal StockQuantity
5 μg$10520 days20 days
10 μg$16920 days20 days
20 μg$28320 days20 days
50 μg$42820 days20 days
100 μg$59020 days20 days
200 μg$91320 days20 days
500 μg$1,62020 days20 days
1 mg$2,53020 days20 days
Add to Cart
Add to Quotation
For In stock only · Estimated delivery:USA Stock (1-2 days) Global Stock (5-7 days)
For research use only—not for human use. No sales to individuals. Use as intended only.
Questions
View More

Batch Information

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
May be part of an oligomeric complex which is likely to have a transport or channel function in the erythrocyte membrane. RHD Protein, Human, Recombinant (GST & His) is expressed in E. coli expression system with N-6xHis-GST tag. The predicted molecular weight is 33.6 kDa and the accession number is Q02161.
Species
Human
Expression System
E. coli
TagN-6xHis-GST
Accession NumberQ02161
Synonyms
RHXIII,Rhesus D antigen,RHD,Rh polypeptide 2 (RhPII),CD240D,Blood group Rh(D) polypeptide
Amino Acid
LNLKIWKAPHEAKYFDDQVFWKFPHLAVGF
Construction
388-417 aa
Protein Purity
> 85% as determined by SDS-PAGE.
Molecular Weight33.6 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationTris-based buffer, 50% glycerol
Reconstitution
A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Research Background
May be part of an oligomeric complex which is likely to have a transport or channel function in the erythrocyte membrane.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords