Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

RBMX Protein, Human, Recombinant (GST)

TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-02052 Copy Product Info
RBMX Protein, Human, Recombinant (GST) is expressed in E. coli.

RBMX Protein, Human, Recombinant (GST)

Catalog No. TMPH-02052
Copy Product Info
TargetMol | SPR Buffer-Exchangeable

RBMX Protein, Human, Recombinant (GST) is expressed in E. coli.

RBMX Protein, Human, Recombinant (GST)
Pack SizePriceUSA StockGlobal StockQuantity
5 μg$10520 days20 days
10 μg$16920 days20 days
20 μg$28320 days20 days
50 μg$42820 days20 days
100 μg$59020 days20 days
200 μg$91320 days20 days
500 μg$1,62020 days20 days
1 mg$2,53020 days20 days
Add to Cart
Add to Quotation
For In stock only · Estimated delivery:USA Stock (1-2 days) Global Stock (5-7 days)
For research use only—not for human use. No sales to individuals. Use as intended only.
Questions
View More

Batch Information

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
RBMX Protein, Human, Recombinant (GST) is expressed in E. coli.
Species
Human
Expression System
E. coli
TagN-GST
Accession NumberP38159
Synonyms
X chromosome,RNA-binding motif protein, X chromosome,RBMXP1,RBMX,HNRPG,Heterogeneous nuclear ribonucleoprotein G (hnRNP G),Glycoprotein p43
Amino Acid
DLYSSGRDRVGRQERGLPPSMERGYPPPRDSYSSSSRGAPRGGGRGGSRSDRGGGRSRY
Construction
333-391 aa
Protein Purity
> 85% as determined by SDS-PAGE.
Molecular Weight33.4 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationTris-based buffer, 50% glycerol
Reconstitution
A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Research Background
RNA-binding protein that plays several role in the regulation of pre- and post-transcriptional processes. Implicated in tissue-specific regulation of gene transcription and alternative splicing of several pre-mRNAs. Binds to and stimulates transcription from the tumor suppressor TXNIP gene promoter; may thus be involved in tumor suppression. When associated with SAFB, binds to and stimulates transcription from the SREBF1 promoter. Associates with nascent mRNAs transcribed by RNA polymerase II. Component of the supraspliceosome complex that regulates pre-mRNA alternative splice site selection. Can either activate or suppress exon inclusion; acts additively with TRA2B to promote exon 7 inclusion of the survival motor neuron SMN2. Represses the splicing of MAPT/Tau exon 10. Binds preferentially to single-stranded 5'-CC[A/C]-rich RNA sequence motifs localized in a single-stranded conformation; probably binds RNA as a homodimer. Binds non-specifically to pre-mRNAs. Plays also a role in the cytoplasmic TNFR1 trafficking pathways; promotes both the IL-1-beta-mediated inducible proteolytic cleavage of TNFR1 ectodomains and the release of TNFR1 exosome-like vesicles to the extracellular compartment.

Citations

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Dose Conversion

You can also refer to dose conversion for different animals. More

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords