RBMX Protein, Human, Recombinant (GST)

Name: RBMX Protein, Human, Recombinant (GST)
Brand: TargetMol
SKU: TMPH-02052
Rating: 4.5 (1 reviews)

(Synonyms: X chromosome, RNA-binding motif protein, X chromosome, RBMXP1, RBMX, HNRPG, Heterogeneous nuclear ribonucleoprotein G (hnRNP G), Glycoprotein p43) Copy Product Info

Synonyms: X chromosome, RNA-binding motif protein, X chromosome, RBMXP1, RBMX, HNRPG, Heterogeneous nuclear ribonucleoprotein G (hnRNP G), Glycoprotein p43

Catalog No. TMPH-02052 Copy Product Info

RBMX Protein, Human, Recombinant (GST) is expressed in E. coli.

Customer service consultation

Pack Size	Price	USA Stock	Global Stock
5 μg	$105	20 days	20 days
10 μg	$169	20 days	20 days
20 μg	$283	20 days	20 days
50 μg	$428	20 days	20 days
100 μg	$590	20 days	20 days
200 μg	$913	20 days	20 days
500 μg	$1,620	20 days	20 days
1 mg	$2,530	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Resource Download

User Guide of Recombinant Proteins

Product Introduction

Bioactivity

Bioactivity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	RBMX Protein, Human, Recombinant (GST) is expressed in E. coli.
Species	Human
Expression System	E. coli
Tag	N-GST
Accession Number	P38159
Amino Acid	DLYSSGRDRVGRQERGLPPSMERGYPPPRDSYSSSSRGAPRGGGRGGSRSDRGGGRSRY
Construction	333-391 aa
Protein Purity	> 85% as determined by SDS-PAGE.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Tris-based buffer, 50% glycerol
Reconstitution	A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Synonyms	X chromosome, RNA-binding motif protein, X chromosome, RBMXP1, RBMX, HNRPG, Heterogeneous nuclear ribonucleoprotein G (hnRNP G), Glycoprotein p43
Research Background

Chemical Properties

Molecular Weight

33.4 kDa (predicted)

Storage & Solubility Information

Storage

Lyophilized powder: -20~-80°C for 1 year | Solution: -80°C for 6 months

Calculator

Molarity Calculator
Dilution Calculator
Reconstitution Calculator
Molecular Weight Calculator

Dose Conversion

You can also refer to dose conversion for different animals. More Dose Conversion

Tech Support

Please see Inhibitor Handling Instructions for more frequently ask questions. Topics include: how to prepare stock solutions, how to store products, and cautions on cell-based assays & animal experiments, etc

Keywords

RBMXP 1hnRNPGhnRNP G

Related Tags: RBMX Protein, Human, Recombinant (GST) chemical structure | RBMX Protein, Human, Recombinant (GST) molecular weight