Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

RAP2C Protein, Human, Recombinant (His)

TargetMol | SPR
Catalog No. TMPH-04567 Copy Product Info
RAP2C Protein, Human, Recombinant (His) is expressed in E. coli. The accession number is Q9Y3L5.

RAP2C Protein, Human, Recombinant (His)

Catalog No. TMPH-04567
Copy Product Info
TargetMol | SPR

RAP2C Protein, Human, Recombinant (His) is expressed in E. coli. The accession number is Q9Y3L5.

RAP2C Protein, Human, Recombinant (His)
Pack SizePriceUSA StockGlobal StockQuantity
5 μg$9820 days20 days
10 μg$15920 days20 days
20 μg$26620 days20 days
50 μg$37820 days20 days
100 μg$49820 days20 days
200 μg$76920 days20 days
500 μg$1,37020 days20 days
1 mg$2,13020 days20 days
Add to Cart
Add to Quotation
For In stock only · Estimated delivery:USA Stock (1-2 days) Global Stock (5-7 days)
For research use only—not for human use. No sales to individuals. Use as intended only.
Questions
View More

Batch Information

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
RAP2C Protein, Human, Recombinant (His) is expressed in E. coli. The accession number is Q9Y3L5.
Species
Human
Expression System
E. coli
TagC-6xHis
Accession NumberQ9Y3L5
Synonyms
Ras-related protein Rap-2c,RAP2C
Amino Acid
MREYKVVVLGSGGVGKSALTVQFVTGTFIEKYDPTIEDFYRKEIEVDSSPSVLEILDTAGTEQFASMRDLYIKNGQGFILVYSLVNQQSFQDIKPMRDQIVRVKRYEKVPLILVGNKVDLEPEREVMSSEGRALAQEWGCPFMETSAKSKSMVDELFAEIVRQMNYSSLPEKQDQCCTTC
Construction
1-180 aa
Protein Purity
> 95% as determined by SDS-PAGE.
Molecular Weight27.3 kDa (Predicted)
EndotoxinNot tested.
FormulationLyophilized from PBS, 6% Trehalose, pH 7.4
Reconstitution
Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 204 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.