RAC1 Protein, Human, Recombinant (E. coli, His)

Catalog No. TMPH-04099

RAC1 Protein, Human, Recombinant (E. coli, His) is expressed in E. coli with N-10xHis. The accession number is P63000.

RAC1 Protein, Human, Recombinant (E. coli, His)

Catalog No. TMPH-04099

RAC1 Protein, Human, Recombinant (E. coli, His) is expressed in E. coli with N-10xHis. The accession number is P63000.

Pack Size	Price	USA Warehouse	Global Warehouse
5 μg	$75	20 days	20 days
10 μg	$119	20 days	20 days
20 μg	$198	20 days	20 days
50 μg	$288	20 days	20 days
100 μg	$389	20 days	20 days
200 μg	$589	20 days	20 days
500 μg	$1,070	20 days	20 days
1 mg	$1,680	20 days	20 days

Add to Cart

Add to Quotation

In Stock Estimated shipping dateUSA Warehouse [1-2 days] Global Warehouse [5-7 days]

All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.

Questions

Resource Download

User Guide of Recombinant Proteins

Product Information

Biological Activity	Activity has not been tested. It is theoretically active, but we cannot guarantee it.
Description	RAC1 Protein, Human, Recombinant (E. coli, His) is expressed in E. coli with N-10xHis. The accession number is P63000.
Species	Human
Expression System	E. coli
Tag	N-10xHis
Accession Number	P63000
Synonyms	TC25,Ras-related C3 botulinum toxin substrate 1,Ras-like protein TC25,RAC1,p21-Rac1,Cell migration-inducing gene 5 protein
Amino Acid	MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTVGETYGKDITSRGKDKPIADVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPPPVKKRKRKC
Construction	1-208 aa
Protein Purity	>95% as determined by SDS-PAGE.
Molecular Weight	26.8 kDa (Predicted)
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
Shipping	In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

Reconstitution Calculator
Recombinant Protein Dilution Calculator
Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords

TC 25 RAC 1 p21-Rac 1