PTPRZ1 Protein, Human, Recombinant (His)

Name: PTPRZ1 Protein, Human, Recombinant (His)
Brand: TargetMol
SKU: TMPH-02013
Rating: 4.5 (1 reviews)

(Synonyms: R-PTP-zeta-2, R-PTP-zeta, Receptor-type tyrosine-protein phosphatase zeta, PTPZ, PTPRZ2, PTPRZ1, PTPRZ, Protein-tyrosine phosphatase receptor type Z polypeptide 2, Protein-tyrosine phosphatase receptor type Z polypeptide 1, HTPZP2) Copy Product Info

Synonyms: R-PTP-zeta-2, R-PTP-zeta, Receptor-type tyrosine-protein phosphatase zeta, PTPZ, PTPRZ2, PTPRZ1, PTPRZ, Protein-tyrosine phosphatase receptor type Z polypeptide 2, Protein-tyrosine phosphatase receptor type Z polypeptide 1, HTPZP2

Catalog No. TMPH-02013 Copy Product Info

Protein tyrosine phosphatase that negatively regulates oligodendrocyte precursor proliferation in the embryonic spinal cord. Required for normal differentiation of the precursor cells into mature, fully myelinating oligodendrocytes. May play a role in protecting oligondendrocytes against apoptosis. May play a role in the establishment of contextual memory, probably via the dephosphorylation of proteins that are part of important signaling cascades. PTPRZ1 Protein, Human, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 32.1 kDa and the accession number is P23471.

PTPRZ1 Protein, Human, Recombinant (His)

Pack Size	Price	USA Stock	Global Stock
5 µg	$86	20 days	20 days
10 µg	$138	20 days	20 days
20 µg	$231	20 days	20 days
50 µg	$348	20 days	20 days
100 µg	$480	20 days	20 days
200 µg	$743	20 days	20 days
500 µg	$1,330	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Batch Information

Select Batch

Purity:90% (SDS-PAGE)

Appearance:Lyophilized powder

Color:White

Resource Download

COA User Guide of Recombinant Proteins

Product Introduction

Bioactivity

Bioactivity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	Protein tyrosine phosphatase that negatively regulates oligodendrocyte precursor proliferation in the embryonic spinal cord. Required for normal differentiation of the precursor cells into mature, fully myelinating oligodendrocytes. May play a role in protecting oligondendrocytes against apoptosis. May play a role in the establishment of contextual memory, probably via the dephosphorylation of proteins that are part of important signaling cascades. PTPRZ1 Protein, Human, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 32.1 kDa and the accession number is P23471.
Species	Human
Expression System	P. pastoris (Yeast)
Tag	N-6xHis
Accession Number	P23471
Amino Acid	IGWSYTGALNQKNWGKKYPTCNSPKQSPINIDEDLTQVNVNLKKLKFQGWDKTSLENTFIHNTGKTVEINLTNDYRVSGGVSEMVFKASKITFHWGKCNMSSDGSEHSLEGQKFPLEMQIYCFDADRFSSFEEAVKGKGKLRALSILFEVGTEENLDFKAIIDGVESVSRFGKQAALDPFILLNLLPNSTDKYYIYNGSLTSPPCTDTVDWIVFKDTVSISESQLAVFCEVLTMQQSGYVMLMDYLQNNFREQQYKFSRQVFSSY
Construction	36-300 aa
Protein Purity	> 90% as determined by SDS-PAGE.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Tris-based buffer, 50% glycerol
Reconstitution	A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Synonyms	R-PTP-zeta-2, R-PTP-zeta, Receptor-type tyrosine-protein phosphatase zeta, PTPZ, PTPRZ2, PTPRZ1, PTPRZ, Protein-tyrosine phosphatase receptor type Z polypeptide 2, Protein-tyrosine phosphatase receptor type Z polypeptide 1, HTPZP2
Research Background	Protein tyrosine phosphatase that negatively regulates oligodendrocyte precursor proliferation in the embryonic spinal cord. Required for normal differentiation of the precursor cells into mature, fully myelinating oligodendrocytes. May play a role in protecting oligondendrocytes against apoptosis. May play a role in the establishment of contextual memory, probably via the dephosphorylation of proteins that are part of important signaling cascades.

Chemical Properties

Molecular Weight

32.1 kDa (predicted)

Storage & Solubility Information

Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.