Shopping Cart
  • Remove All
  • TargetMol
    Your shopping cart is currently empty

PTPRZ1 Protein, Human, Recombinant (E. coli, His)

Catalog No. TMPH-02012

PTPRZ1 Protein, Human, Recombinant (E. coli, His) is expressed in E. coli.

PTPRZ1 Protein, Human, Recombinant (E. coli, His)

PTPRZ1 Protein, Human, Recombinant (E. coli, His)

Catalog No. TMPH-02012
PTPRZ1 Protein, Human, Recombinant (E. coli, His) is expressed in E. coli.
Pack SizePriceAvailabilityQuantity
20 μg $19820 days
100 μg $42720 days
1 mg $1,83020 days
Bulk & Custom
Add to Cart
Questions
View More
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
PTPRZ1 Protein, Human, Recombinant (E. coli, His) is expressed in E. coli.
Species
Human
Expression System
E. coli
TagN-6xHis
Accession NumberP23471
Synonyms
R-PTP-zeta-2,R-PTP-zeta,Receptor-type tyrosine-protein phosphatase zeta,PTPZ,PTPRZ2,PTPRZ1,PTPRZ,Protein-tyrosine phosphatase receptor type Z polypeptide 2,Protein-tyrosine phosphatase receptor type Z polypeptide 1,HTPZP2
Amino Acid
IGWSYTGALNQKNWGKKYPTCNSPKQSPINIDEDLTQVNVNLKKLKFQGWDKTSLENTFIHNTGKTVEINLTNDYRVSGGVSEMVFKASKITFHWGKCNMSSDGSEHSLEGQKFPLEMQIYCFDADRFSSFEEAVKGKGKLRALSILFEVGTEENLDFKAIIDGVESVSRFGKQAALDPFILLNLLPNSTDKYYIYNGSLTSPPCTDTVDWIVFKDTVSISESQLAVFCEVLTMQQSGYVMLMDYLQNNFREQQYKFSRQVFSSY
Construction
36-300 aa
Protein Purity
> 85% as determined by SDS-PAGE.
Molecular Weight34.1 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationTris-based buffer, 50% glycerol
Reconstitution
A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.
Research Background
Protein tyrosine phosphatase that negatively regulates oligodendrocyte precursor proliferation in the embryonic spinal cord. Required for normal differentiation of the precursor cells into mature, fully myelinating oligodendrocytes. May play a role in protecting oligondendrocytes against apoptosis. May play a role in the establishment of contextual memory, probably via the dephosphorylation of proteins that are part of important signaling cascades.

Dose Conversion

You can also refer to dose conversion for different animals. More

Sci Citations

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords