PTPRZ1 Protein, Human, Recombinant (E. coli, His)

Catalog No. TMPH-02012

PTPRZ1 Protein, Human, Recombinant (E. coli, His) is expressed in E. coli.

PTPRZ1 Protein, Human, Recombinant (E. coli, His)

Catalog No. TMPH-02012

PTPRZ1 Protein, Human, Recombinant (E. coli, His) is expressed in E. coli.

Pack Size	Price	USA Warehouse	Global Warehouse
5 μg	$75	20 days	20 days
10 μg	$119	20 days	20 days
20 μg	$198	20 days	20 days
50 μg	$297	20 days	20 days
100 μg	$427	20 days	20 days
200 μg	$658	20 days	20 days
500 μg	$1,170	20 days	20 days
1 mg	$1,830	20 days	20 days

Add to Cart

Add to Quotation

In Stock Estimated shipping dateUSA Warehouse [1-2 days] Global Warehouse [5-7 days]

All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.

Questions

Resource Download

User Guide of Recombinant Proteins

Product Information

Biological Activity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	PTPRZ1 Protein, Human, Recombinant (E. coli, His) is expressed in E. coli.
Species	Human
Expression System	E. coli
Tag	N-6xHis
Accession Number	P23471
Synonyms	R-PTP-zeta-2,R-PTP-zeta,Receptor-type tyrosine-protein phosphatase zeta,PTPZ,PTPRZ2,PTPRZ1,PTPRZ,Protein-tyrosine phosphatase receptor type Z polypeptide 2,Protein-tyrosine phosphatase receptor type Z polypeptide 1,HTPZP2
Amino Acid	IGWSYTGALNQKNWGKKYPTCNSPKQSPINIDEDLTQVNVNLKKLKFQGWDKTSLENTFIHNTGKTVEINLTNDYRVSGGVSEMVFKASKITFHWGKCNMSSDGSEHSLEGQKFPLEMQIYCFDADRFSSFEEAVKGKGKLRALSILFEVGTEENLDFKAIIDGVESVSRFGKQAALDPFILLNLLPNSTDKYYIYNGSLTSPPCTDTVDWIVFKDTVSISESQLAVFCEVLTMQQSGYVMLMDYLQNNFREQQYKFSRQVFSSY
Construction	36-300 aa
Protein Purity	> 85% as determined by SDS-PAGE.
Molecular Weight	34.1 kDa (predicted)
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Tris-based buffer, 50% glycerol
Reconstitution	A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
Shipping	In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.
Research Background	Protein tyrosine phosphatase that negatively regulates oligodendrocyte precursor proliferation in the embryonic spinal cord. Required for normal differentiation of the precursor cells into mature, fully myelinating oligodendrocytes. May play a role in protecting oligondendrocytes against apoptosis. May play a role in the establishment of contextual memory, probably via the dephosphorylation of proteins that are part of important signaling cascades.