PSMB2 Protein, Human, Recombinant (GST)

Name: PSMB2 Protein, Human, Recombinant (GST)
Brand: TargetMol
SKU: TMPH-01927
Rating: 4.5 (1 reviews)

(Synonyms: PSMB2, Proteasome subunit beta-4 (beta-4), Proteasome subunit beta type-2, Proteasome component C7-I, Multicatalytic endopeptidase complex subunit C7-I, Macropain subunit C7-I) Copy Product Info

Synonyms: PSMB2, Proteasome subunit beta-4 (beta-4), Proteasome subunit beta type-2, Proteasome component C7-I, Multicatalytic endopeptidase complex subunit C7-I, Macropain subunit C7-I

Catalog No. TMPH-01927 Copy Product Info

PSMB2 Protein, Human, Recombinant (GST) is expressed in E. coli.

Customer service consultation

Pack Size	Price	USA Stock	Global Stock
5 µg	$75	20 days	20 days
10 µg	$119	20 days	20 days
20 µg	$198	20 days	20 days
50 µg	$297	20 days	20 days
100 µg	$427	20 days	20 days
200 µg	$658	20 days	20 days
500 µg	$1,170	20 days	20 days
1 mg	$1,830	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Resource Download

User Guide of Recombinant Proteins

Product Introduction

Bioactivity

Bioactivity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	PSMB2 Protein, Human, Recombinant (GST) is expressed in E. coli.
Species	Human
Expression System	E. coli
Tag	N-GST
Accession Number	P49721
Amino Acid	MEYLIGIQGPDYVLVASDRVAASNIVQMKDDHDKMFKMSEKILLLCVGEAGDTVQFAEYIQKNVQLYKMRNGYELSPTAAANFTRRNLADCLRSRTPYHVNLLLAGYDEHEGPALYYMDYLAALAKAPFAAHGYGAFLTLSILDRYYTPTISRERAVELLRKCLEELQKRFILNLPTFSVRIIDKNGIHDLDNISFPKQGS
Construction	1-201 aa
Protein Purity	> 90% as determined by SDS-PAGE.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Tris-based buffer, 50% glycerol
Reconstitution	A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Synonyms	PSMB2, Proteasome subunit beta-4 (beta-4), Proteasome subunit beta type-2, Proteasome component C7-I, Multicatalytic endopeptidase complex subunit C7-I, Macropain subunit C7-I
Research Background	Non-catalytic component of the 20S core proteasome complex involved in the proteolytic degradation of most intracellular proteins. This complex plays numerous essential roles within the cell by associating with different regulatory particles. Associated with two 19S regulatory particles, forms the 26S proteasome and thus participates in the ATP-dependent degradation of ubiquitinated proteins. The 26S proteasome plays a key role in the maintenance of protein homeostasis by removing misfolded or damaged proteins that could impair cellular functions, and by removing proteins whose functions are no longer required. Associated with the PA200 or PA28, the 20S proteasome mediates ubiquitin-independent protein degradation. This type of proteolysis is required in several pathways including spermatogenesis (20S-PA200 complex) or generation of a subset of MHC class I-presented antigenic peptides (20S-PA28 complex).

Chemical Properties

Molecular Weight

49.8 kDa (predicted)

Storage & Solubility Information

Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.