PSENEN Protein, Human, Recombinant (His)

Name: PSENEN Protein, Human, Recombinant (His)
Brand: TargetMol
SKU: TMPH-01369
Rating: 4.5 (1 reviews)

(Synonyms: PSENEN, Presenilin enhancer protein 2, PEN2, Gamma-secretase subunit PEN-2) Copy Product Info

Synonyms: PSENEN, Presenilin enhancer protein 2, PEN2, Gamma-secretase subunit PEN-2

Catalog No. TMPH-01369 Copy Product Info

PSENEN Protein, Human, Recombinant (His) is expressed in E. coli expression system with N-10xHis tag. The predicted molecular weight is 14.8 kDa and the accession number is Q9NZ42.

Customer service consultation

Pack Size	Price	USA Stock	Global Stock
5 µg	$526	20 days	20 days
10 µg	$886	20 days	20 days
20 µg	$1,500	20 days	20 days
50 µg	$2,090	20 days	20 days
100 µg	$2,750	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Resource Download

User Guide of Recombinant Proteins

Product Introduction

Bioactivity

Bioactivity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	PSENEN Protein, Human, Recombinant (His) is expressed in E. coli expression system with N-10xHis tag. The predicted molecular weight is 14.8 kDa and the accession number is Q9NZ42.
Species	Human
Expression System	E. coli
Tag	N-10xHis
Accession Number	Q9NZ42
Amino Acid	MNLERVSNEEKLNLCRKYYLGGFAFLPFLWLVNIFWFFREAFLVPAYTEQSQIKGYVWRSAVGFLFWVIVLTSWITIFQIYRPRWGALGDYLSFTIPLGTP
Construction	1-101 aa
Protein Purity	> 85% as determined by SDS-PAGE.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution	A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Synonyms	PSENEN, Presenilin enhancer protein 2, PEN2, Gamma-secretase subunit PEN-2
Research Background	Essential subunit of the gamma-secretase complex, an endoprotease complex that catalyzes the intramembrane cleavage of integral membrane proteins such as Notch receptors and APP (amyloid-beta precursor protein). The gamma-secretase complex plays a role in Notch and Wnt signaling cascades and regulation of downstream processes via its role in processing key regulatory proteins, and by regulating cytosolic CTNNB1 levels (Probable). PSENEN modulates both endoproteolysis of presenilin and gamma-secretase activity.

Chemical Properties

Molecular Weight

14.8 kDa (predicted)

Storage & Solubility Information

Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.