Prolactin Protein, Horse, Recombinant (hFc)

Catalog No. TMPH-00834

Prolactin acts primarily on the mammary gland by promoting lactation. Prolactin Protein, Horse, Recombinant (hFc) is expressed in HEK293 mammalian cells with C-hFC tag. The predicted molecular weight is 51.9 kDa and the accession number is P12420.

Prolactin Protein, Horse, Recombinant (hFc)

Catalog No. TMPH-00834

Pack Size	Price	Availability
5 μg	$133	20 days
10 μg	$219	20 days
20 μg	$368	20 days
50 μg	$678	20 days
100 μg	$1,080	20 days
200 μg	$1,680	20 days
500 μg	$2,970	20 days
1 mg	$4,770	20 days

Bulk & Custom

Add to Cart

All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.

Questions

Resource Download

User Guide of Recombinant Proteins

Product Information

Biological Activity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	Prolactin acts primarily on the mammary gland by promoting lactation. Prolactin Protein, Horse, Recombinant (hFc) is expressed in HEK293 mammalian cells with C-hFC tag. The predicted molecular weight is 51.9 kDa and the accession number is P12420.
Species	Horse
Expression System	HEK293 Cells
Tag	C-hFC
Accession Number	P12420
Synonyms	Prolactin,PRL
Amino Acid	LPICPSGAVNCQVSLRELFDRAVILSHYIHNLSSEMFNEFDKRYAQGRGFVTKAINSCHTSSLSTPEDKEQAQQIHHEDLLNLILRVLRSWNDPLYHLVSEVRGMQEAPEAILSKAIEIEEQNRRLLEGMEKIVGQVQPRIKENEVYSVWSGLPSLQMADEDSRLFAFYNLLHCLRRDSHKIDNYLKLLKCRIVYDSNC
Construction	31-229 aa
Protein Purity	> 85% as determined by SDS-PAGE.
Molecular Weight	51.9 kDa (predicted)
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
Shipping	In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.
Research Background	Prolactin acts primarily on the mammary gland by promoting lactation.