Shopping Cart
  • Remove All
  • TargetMol
    Your shopping cart is currently empty

Prolactin Protein, Horse, Recombinant (hFc)

TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-00834

Prolactin acts primarily on the mammary gland by promoting lactation. Prolactin Protein, Horse, Recombinant (hFc) is expressed in HEK293 mammalian cells with C-hFC tag. The predicted molecular weight is 51.9 kDa and the accession number is P12420.

Prolactin Protein, Horse, Recombinant (hFc)

Prolactin Protein, Horse, Recombinant (hFc)

TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-00834
Prolactin acts primarily on the mammary gland by promoting lactation. Prolactin Protein, Horse, Recombinant (hFc) is expressed in HEK293 mammalian cells with C-hFC tag. The predicted molecular weight is 51.9 kDa and the accession number is P12420.
Pack SizePriceAvailabilityQuantity
5 μg$13320 days
10 μg$21920 days
20 μg$36820 days
50 μg$67820 days
100 μg$1,08020 days
200 μg$1,68020 days
500 μg$2,97020 days
1 mg$4,77020 days
Bulk & Custom
Add to Cart
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.
Questions
View More

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
Prolactin acts primarily on the mammary gland by promoting lactation. Prolactin Protein, Horse, Recombinant (hFc) is expressed in HEK293 mammalian cells with C-hFC tag. The predicted molecular weight is 51.9 kDa and the accession number is P12420.
Species
Horse
Expression System
HEK293 Cells
TagC-hFC
Accession NumberP12420
Synonyms
Prolactin,PRL
Amino Acid
LPICPSGAVNCQVSLRELFDRAVILSHYIHNLSSEMFNEFDKRYAQGRGFVTKAINSCHTSSLSTPEDKEQAQQIHHEDLLNLILRVLRSWNDPLYHLVSEVRGMQEAPEAILSKAIEIEEQNRRLLEGMEKIVGQVQPRIKENEVYSVWSGLPSLQMADEDSRLFAFYNLLHCLRRDSHKIDNYLKLLKCRIVYDSNC
Construction
31-229 aa
Protein Purity
> 85% as determined by SDS-PAGE.
Molecular Weight51.9 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationIf the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.
Research Background
Prolactin acts primarily on the mammary gland by promoting lactation.

Dose Conversion

You can also refer to dose conversion for different animals. More

Sci Citations

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.