Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

PRA1 Protein, Candida albicans, Recombinant (His)

TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-00338 Copy Product Info
PRA1 Protein, Candida albicans, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 33.4 kDa and the accession number is P87020.

PRA1 Protein, Candida albicans, Recombinant (His)

Catalog No. TMPH-00338
Copy Product Info
TargetMol | SPR Buffer-Exchangeable

PRA1 Protein, Candida albicans, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 33.4 kDa and the accession number is P87020.

PRA1 Protein, Candida albicans, Recombinant (His)
Pack SizePriceUSA StockGlobal StockQuantity
5 μg$12520 days20 days
10 μg$19820 days20 days
20 μg$34120 days20 days
50 μg$49720 days20 days
100 μg$69620 days20 days
200 μg$1,08020 days20 days
500 μg$1,95020 days20 days
Add to Cart
Add to Quotation
For In stock only · Estimated delivery:USA Stock (1-2 days) Global Stock (5-7 days)
For research use only—not for human use. No sales to individuals. Use as intended only.
Questions
View More

Batch Information

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
PRA1 Protein, Candida albicans, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 33.4 kDa and the accession number is P87020.
Species
Candida albicans
Expression System
P. pastoris (Yeast)
TagN-6xHis
Accession NumberP87020
Synonyms
PRA1,pH-regulated antigen PRA1,FBP1,58 kDa fibrinogen-binding mannoprotein
Amino Acid
APVTVTRFVDASPTGYDWRADWVKGFPIDSSCNATQYNQLSTGLQEAQLLAEHARDHTLRFGSKSPFFRKYFGNETASAEVVGHFDNVVGADKSSILFLCDDLDDKCKNDGWAGYWRGSNHSDQTIICDLSFVTRRYLTQLCSSGYTVSKSKTNIFWAGDLLHRFWHLKSIGQLVIEHYADTYEEVLELAQENSTYAVRNSNSLIYYALDVYAYDVTIPGEGCNGDGTSYKKSDFSSFEDSDSGSDSGASSTASSSHQHTDSNPSATTDANSHCHTHADGEVHC
Construction
16-299 aa
Protein Purity
> 90% as determined by SDS-PAGE.
Molecular Weight33.4 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationTris-based buffer, 50% glycerol
Reconstitution
A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Research Background
Cell surface protein involved in the host-parasite interaction during candidal infection. With MP65, represents a major component of the biofilm matrix. Sequesters zinc from host tissue and mediates leukocyte adhesion and migration. As a surface protein, binds the two human complement regulators CFH and CFHR1, as well as plasminogen PLG, mediates complement evasion and extra-cellular matrix interaction and/or degradation. As a released protein, enhances complement control in direct vicinity of the yeast and thus generates an additional protective layer which controls host complement attack, assisting the fungus in escaping host surveillance. Binds to host fluid-phase C3 and blocks cleavage of C3 to C3a and C3b, leading to inhibition of complement activation. Mediates also human complement control and complement evasion through binding to C4BPA, another human complement inhibitor, as well as through binding to host integrin alpha-M/beta-2. Decreases complement-mediated adhesion, as well as uptake of C.albicans by human macrophages.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords