PPARD Protein, Human, Recombinant (GST)

Name: PPARD Protein, Human, Recombinant (GST)
Brand: TargetMol
SKU: TMPH-04587
Rating: 4.5 (1 reviews)

(Synonyms: PPAR-delta, PPARD, PPARB, Peroxisome proliferator-activated receptor delta, Peroxisome proliferator-activated receptor beta (PPAR-beta), Nuclear receptor subfamily 1 group C member 2, Nuclear hormone receptor 1 (NUC1), NUCI, NR1C2) Copy Product Info

Synonyms: PPAR-delta, PPARD, PPARB, Peroxisome proliferator-activated receptor delta, Peroxisome proliferator-activated receptor beta (PPAR-beta), Nuclear receptor subfamily 1 group C member 2, Nuclear hormone receptor 1 (NUC1), NUCI, NR1C2

Catalog No. TMPH-04587 Copy Product Info

PPARD Protein, Human, Recombinant (GST) is expressed in E. coli. The accession number is Q03181.

Customer service consultation

Pack Size	Price	USA Stock	Global Stock
5 µg	$116	20 days	20 days
10 µg	$189	20 days	20 days
20 µg	$317	20 days	20 days
50 µg	$448	20 days	20 days
100 µg	$588	20 days	20 days
200 µg	$913	20 days	20 days
500 µg	$1,630	20 days	20 days
1 mg	$2,550	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Resource Download

User Guide of Recombinant Proteins

Product Introduction

Bioactivity

Bioactivity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	PPARD Protein, Human, Recombinant (GST) is expressed in E. coli. The accession number is Q03181.
Species	Human
Expression System	E. coli
Tag	N-GST
Accession Number	Q03181
Amino Acid	GSQYNPQVADLKAFSKHIYNAYLKNFNMTKKKARSILTGKASHTAPFVIHDIETLWQAEKGLVWKQLVNGLPPYKEISVHVFYRCQCTTVETVRELTEFAKSIPSFSSLFLNDQVTLLKYGVHEAIFAMLASIVNKDGLLVANGSGFVTREFLRSLRKPFSDIIEPKFEFAVKFNALELDDSDLALFIAAIILCGDRPGLMNVPRVEAIQDTILRALEFHLQANHPDAQYLFPKLLQKMADLRQLVTEHAQMMQRIKKTETETSLHPLLQEIYKDMY
Construction	165-441 aa
Protein Purity	> 85% as determined by SDS-PAGE.
Endotoxin	Not tested.
Formulation	Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
Reconstitution	Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Synonyms	PPAR-delta, PPARD, PPARB, Peroxisome proliferator-activated receptor delta, Peroxisome proliferator-activated receptor beta (PPAR-beta), Nuclear receptor subfamily 1 group C member 2, Nuclear hormone receptor 1 (NUC1), NUCI, NR1C2

Chemical Properties

Molecular Weight

58.4 kDa (Predicted)

Storage & Solubility Information

Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 224 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.