Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.

PPARD Protein, Human, Recombinant (GST) is expressed in E. coli. The accession number is Q03181.

Human

E. coli

PPAR-delta,PPARD,PPARB,Peroxisome proliferator-activated receptor delta,Peroxisome proliferator-activated receptor beta (PPAR-beta),Nuclear receptor subfamily 1 group C member 2,Nuclear hormone receptor 1 (NUC1),NUCI,NR1C2

GSQYNPQVADLKAFSKHIYNAYLKNFNMTKKKARSILTGKASHTAPFVIHDIETLWQAEKGLVWKQLVNGLPPYKEISVHVFYRCQCTTVETVRELTEFAKSIPSFSSLFLNDQVTLLKYGVHEAIFAMLASIVNKDGLLVANGSGFVTREFLRSLRKPFSDIIEPKFEFAVKFNALELDDSDLALFIAAIILCGDRPGLMNVPRVEAIQDTILRALEFHLQANHPDAQYLFPKLLQKMADLRQLVTEHAQMMQRIKKTETETSLHPLLQEIYKDMY

165-441 aa

> 85% as determined by SDS-PAGE.

Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.

Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 224 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.