Shopping Cart
  • Remove All
  • TargetMol
    Your shopping cart is currently empty

Pmp22 Protein, Rat, Recombinant (His)

Catalog No. TMPH-03350

Might be involved in growth regulation, and in myelinization in the peripheral nervous system. Pmp22 Protein, Rat, Recombinant (His) is expressed in E. coli expression system with N-10xHis tag. The predicted molecular weight is 23.4 kDa and the accession number is P25094.

Pmp22 Protein, Rat, Recombinant (His)

Pmp22 Protein, Rat, Recombinant (His)

Catalog No. TMPH-03350
Might be involved in growth regulation, and in myelinization in the peripheral nervous system. Pmp22 Protein, Rat, Recombinant (His) is expressed in E. coli expression system with N-10xHis tag. The predicted molecular weight is 23.4 kDa and the accession number is P25094.
Pack SizePriceAvailabilityQuantity
20 μg$1,50020 days
100 μg$2,75020 days
Bulk & Custom
Add to Cart
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.
Questions
View More

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
Might be involved in growth regulation, and in myelinization in the peripheral nervous system. Pmp22 Protein, Rat, Recombinant (His) is expressed in E. coli expression system with N-10xHis tag. The predicted molecular weight is 23.4 kDa and the accession number is P25094.
Species
Rat
Expression System
E. coli
TagN-10xHis
Accession NumberP25094
Synonyms
SR13 myelin protein,Schwann cell membrane glycoprotein (SAG),Protein CD25,PMP-22,Pmp-22,Pmp22,Peripheral myelin protein 22,Cd25
Amino Acid
MLLLLLGILFLHIAVLVLLFVSTIVSQWLVGNGHRTDLWQNCTTSALGAVQHCYSSSVSEWLQSVQATMILSVIFSVLSLFLFFCQLFTLTKGGRFYITGVFQILAGLCVMSAAAIYTVRHSEWHVNNDYSYGFAYILAWVAFPLALLSGIIYVILRKRE
Construction
1-160 aa
Protein Purity
> 85% as determined by SDS-PAGE.
Molecular Weight23.4 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationLyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution
A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.
Research Background
Might be involved in growth regulation, and in myelinization in the peripheral nervous system.

Dose Conversion

You can also refer to dose conversion for different animals. More

Sci Citations

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords