Shopping Cart
Remove All
Your shopping cart is currently empty
Receptor for SEMA4D. Plays a role in GABAergic synapse development. Mediates SEMA4A- and SEMA4D-dependent inhibitory synapse development. Plays a role in RHOA activation and subsequent changes of the actin cytoskeleton. Plays a role in axon guidance, invasive growth and cell migration. Plexin-B1 Protein, Human, Recombinant (mFc) is expressed in HEK293 mammalian cells with N-mFc tag. The predicted molecular weight is 83.2 kDa and the accession number is O43157.

| Pack Size | Price | USA Warehouse | Global Warehouse | Quantity |
|---|---|---|---|---|
| 5 μg | $50 | 20 days | 20 days | |
| 10 μg | $79 | 20 days | 20 days | |
| 20 μg | $127 | 20 days | 20 days | |
| 50 μg | $225 | 20 days | 20 days | |
| 100 μg | $350 | 20 days | 20 days | |
| 200 μg | $633 | 20 days | 20 days | |
| 500 μg | $1,390 | 20 days | 20 days | |
| 1 mg | $2,550 | 20 days | 20 days |
| Biological Activity | Measured by its binding ability in a functional ELISA. Immobilized human SEMA4D at 5 μg/mL can bind human PLXNB1, the EC 50 is 0.8179-1.357 μg/mL. |
| Description | Receptor for SEMA4D. Plays a role in GABAergic synapse development. Mediates SEMA4A- and SEMA4D-dependent inhibitory synapse development. Plays a role in RHOA activation and subsequent changes of the actin cytoskeleton. Plays a role in axon guidance, invasive growth and cell migration. Plexin-B1 Protein, Human, Recombinant (mFc) is expressed in HEK293 mammalian cells with N-mFc tag. The predicted molecular weight is 83.2 kDa and the accession number is O43157. |
| Species | Human |
| Expression System | HEK293 Cells |
| Tag | N-mFc |
| Accession Number | O43157 |
| Synonyms | SEP,Semaphorin receptor SEP,PLXNB1,PLXN5,Plexin-B1,KIAA0407 |
| Amino Acid | LQPLPPTAFTPNGTYLQHLARDPTSGTLYLGATNFLFQLSPGLQLEATVSTGPVLDSRDCLPPVMPDECPQAQPTNNPNQLLLVSPGALVVCGSVHQGVCEQRRLGQLEQLLLRPERPGDTQYVAANDPAVSTVGLVAQGLAGEPLLFVGRGYTSRGVGGGIPPITTRALWPPDPQAAFSYEETAKLAVGRLSEYSHHFVSAFARGASAYFLFLRRDLQAQSRAFRAYVSRVCLRDQHYYSYVELPLACEGGRYGLIQAAAVATSREVAHGEVLFAAFSSAAPPTVGRPPSAAAGASGASALCAFPLDEVDRLANRTRDACYTREGRAEDGTEVAYIEYDVNSDCAQLPVDTLDAYPCGSDHTPSPMASRVPLEATPILEWPGIQLTAVAVTMEDGHTIAFLGDSQGQLHRVYLGPGSDGHPYSTQSIQQGSAVSRDLTFDGTFEHLYVMTQSTLLKVPVASCAQHLDCASCLAHRDPYCGWCVLLGRCSRRSECSRGQGPEQWLWSFQPELGCLQ |
| Construction | 20-535 aa |
| Protein Purity | > 95% as determined by SDS-PAGE. |
| Molecular Weight | 83.2 kDa (predicted) |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | Lyophilized from a solution filtered through a 0.22 μm filter, containing PBS, 6% Trehalose, pH 7.4 |
| Reconstitution | Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
| Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
| Shipping | In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice. |
| Research Background | Receptor for SEMA4D. Plays a role in GABAergic synapse development. Mediates SEMA4A- and SEMA4D-dependent inhibitory synapse development. Plays a role in RHOA activation and subsequent changes of the actin cytoskeleton. Plays a role in axon guidance, invasive growth and cell migration. |
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.