Shopping Cart
- Remove All
- Your shopping cart is currently empty
PIK3CA Protein, Human, Recombinant (His) is expressed in E. coli with N-6xHis. The accession number is P42336.
Pack Size | Price | Availability | Quantity |
---|---|---|---|
20 μg | $283 | In Stock | |
100 μg | $537 | 20 days | |
1 mg | $2,300 | 20 days |
Biological Activity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. |
Description | PIK3CA Protein, Human, Recombinant (His) is expressed in E. coli with N-6xHis. The accession number is P42336. |
Species | Human |
Expression System | E. coli |
Tag | N-6xHis |
Accession Number | P42336 |
Synonyms | Serine/threonine protein kinase PIK3CA,PtdIns-3-kinase subunit alpha,PIK3CA,PI3-kinase subunit alpha,PI3K-alpha,PI3Kalpha,Phosphoinositide-3-kinase catalytic alpha polypeptide,Phosphoinositide 3-kinase alpha,Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform,Phosphatidylinositol 4,5-bisphosphate 3-kinase 110 kDa catalytic subunit alpha (PtdIns-3-kinase subunit p110-alpha;p110alpha),5-bisphosphate 3-kinase catalytic subunit alpha isoform |
Amino Acid | NEIIFKNGDDLRQDMLTLQIIRIMENIWQNQGLDLRMLPYGCLSIGDCVGLIEVVRNSHTIMQIQCKGGLKGALQFNSHTLHQWLKDKNKGEIYDAAIDLFTRSCAGYCVATFILGIGDRHNSNIMVKDDGQLFHIDFGHFLDHKKKKFGYKRERVPFVLTQDFLIVISKGAQECTKTREFERFQEMCYKAYLAIRQHANLFINLFSMMLGSGMPELQSFDDIAYIRKTLALDKTEQEALEYFMKQMNDAHHGGWTTKMDWIFHTIKQHALN |
Construction | 797-1068 aa |
Protein Purity | >90% as determined by SDS-PAGE. |
Molecular Weight | 33.9 kDa (Predicted) |
Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
Formulation | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
Shipping | In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.