PARP14 Protein, Human, Recombinant (His & Myc)

Name: PARP14 Protein, Human, Recombinant (His & Myc)
Brand: TargetMol
SKU: TMPH-01942
Rating: 4.5 (1 reviews)

(Synonyms: Protein mono-ADP-ribosyltransferase PARP14, Poly [ADP-ribose] polymerase 14 (PARP-14), PARP14, KIAA1268, BAL2, B aggressive lymphoma protein 2, ADP-ribosyltransferase diphtheria toxin-like 8 (ARTD8)) Copy Product Info

Synonyms: Protein mono-ADP-ribosyltransferase PARP14, Poly [ADP-ribose] polymerase 14 (PARP-14), PARP14, KIAA1268, BAL2, B aggressive lymphoma protein 2, ADP-ribosyltransferase diphtheria toxin-like 8 (ARTD8)

Catalog No. TMPH-01942 Copy Product Info

PARP14 Protein, Human, Recombinant (His & Myc) is expressed in HEK293.

Customer service consultation

Pack Size	Price	USA Stock	Global Stock
5 µg	$50	20 days	20 days
10 µg	$79	20 days	20 days
20 µg	$127	-	In Stock
50 µg	$225	20 days	20 days
100 µg	$350	20 days	20 days
200 µg	$633	20 days	20 days
500 µg	$1,390	20 days	20 days
1 mg	$2,550	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Batch Information

Select Batch

Purity:97% (SDS-PAGE)

Appearance:Lyophilized powder

Color:White

Resource Download

COA User Guide of Recombinant Proteins

Product Introduction

Bioactivity

Bioactivity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	PARP14 Protein, Human, Recombinant (His & Myc) is expressed in HEK293.
Species	Human
Expression System	HEK293 Cells
Tag	N-10xHis, C-Myc
Accession Number	Q460N5
Amino Acid	IPAHWSDMKQQNFCVVELLPSDPEYNTVASKFNQTCSHFRIEKIERIQNPDLWNSYQAKKKTMDAKNGQTMNEKQLFHGTDAGSVPHVNRNGFNRSYAGKNAVAYGKGTYFAVNANYSANDTYSRPDANGRKHVYYVRVLTGIYTHGNHSLIVPPSKNPQNPTDLYDTVTDNVHHPSLFVAFYDYQAYPEYLITFRK
Construction	1605-1801 aa
Protein Purity	> 90% as determined by SDS-PAGE.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Synonyms	Protein mono-ADP-ribosyltransferase PARP14, Poly [ADP-ribose] polymerase 14 (PARP-14), PARP14, KIAA1268, BAL2, B aggressive lymphoma protein 2, ADP-ribosyltransferase diphtheria toxin-like 8 (ARTD8)
Research Background	ADP-ribosyltransferase that mediates mono-ADP-ribosylation of glutamate residues on target proteins. In contrast to PARP1 and PARP2, it is not able to mediate poly-ADP-ribosylation. Has been shown to catalyze the mono-ADP-ribosylation of STAT1 at 'Glu-657' and 'Glu-705', thus decreasing STAT1 phosphorylation which negatively regulates pro-inflammatory cytokine production in macrophages in response to IFNG stimulation. However, the role of ADP-ribosylation in the prevention of STAT1 phosphorylation has been called into question and it has been suggested that the inhibition of phosphorylation may be the result of sumoylation of STAT1 'Lys-703'. Mono-ADP-ribosylates STAT6; enhancing STAT6-dependent transcription. In macrophages, positively regulates MRC1 expression in response to IL4 stimulation by promoting STAT6 phosphorylation. Mono-ADP-ribosylates PARP9.

Chemical Properties

Molecular Weight

27.6 kDa (predicted)

Storage & Solubility Information

Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.