Shopping Cart
  • Remove All
  • TargetMol
    Your shopping cart is currently empty

PARP14 Protein, Human, Recombinant (His & Myc)

Catalog No. TMPH-01942

PARP14 Protein, Human, Recombinant (His & Myc) is expressed in HEK293.

PARP14 Protein, Human, Recombinant (His & Myc)

PARP14 Protein, Human, Recombinant (His & Myc)

Catalog No. TMPH-01942
PARP14 Protein, Human, Recombinant (His & Myc) is expressed in HEK293.
Pack SizePriceAvailabilityQuantity
20 μg$12720 days
100 μg$35020 days
1 mg$2,55020 days
Bulk & Custom
Add to Cart
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.
Questions
View More

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
PARP14 Protein, Human, Recombinant (His & Myc) is expressed in HEK293.
Species
Human
Expression System
HEK293 Cells
TagN-10xHis, C-Myc
Accession NumberQ460N5
Synonyms
Protein mono-ADP-ribosyltransferase PARP14,Poly [ADP-ribose] polymerase 14 (PARP-14),PARP14,KIAA1268,BAL2,B aggressive lymphoma protein 2,ADP-ribosyltransferase diphtheria toxin-like 8 (ARTD8)
Amino Acid
IPAHWSDMKQQNFCVVELLPSDPEYNTVASKFNQTCSHFRIEKIERIQNPDLWNSYQAKKKTMDAKNGQTMNEKQLFHGTDAGSVPHVNRNGFNRSYAGKNAVAYGKGTYFAVNANYSANDTYSRPDANGRKHVYYVRVLTGIYTHGNHSLIVPPSKNPQNPTDLYDTVTDNVHHPSLFVAFYDYQAYPEYLITFRK
Construction
1605-1801 aa
Protein Purity
> 90% as determined by SDS-PAGE.
Molecular Weight27.6 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationIf the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.
Research Background
ADP-ribosyltransferase that mediates mono-ADP-ribosylation of glutamate residues on target proteins. In contrast to PARP1 and PARP2, it is not able to mediate poly-ADP-ribosylation. Has been shown to catalyze the mono-ADP-ribosylation of STAT1 at 'Glu-657' and 'Glu-705', thus decreasing STAT1 phosphorylation which negatively regulates pro-inflammatory cytokine production in macrophages in response to IFNG stimulation. However, the role of ADP-ribosylation in the prevention of STAT1 phosphorylation has been called into question and it has been suggested that the inhibition of phosphorylation may be the result of sumoylation of STAT1 'Lys-703'. Mono-ADP-ribosylates STAT6; enhancing STAT6-dependent transcription. In macrophages, positively regulates MRC1 expression in response to IL4 stimulation by promoting STAT6 phosphorylation. Mono-ADP-ribosylates PARP9.

Dose Conversion

You can also refer to dose conversion for different animals. More

Sci Citations

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords