OXT Protein, Human, Recombinant (His)

Name: OXT Protein, Human, Recombinant (His)
Brand: TargetMol
SKU: TMPH-01820
Rating: 4.5 (1 reviews)

(Synonyms: Oxytocin-neurophysin 1, OXT, OT-NPI, OT) Copy Product Info

Synonyms: Oxytocin-neurophysin 1, OXT, OT-NPI, OT

Catalog No. TMPH-01820 Copy Product Info

Purity: 98%

Neurophysin 1 specifically binds oxytocin.; Oxytocin causes contraction of the smooth muscle of the uterus and of the mammary gland. Acts by binding to oxytocin receptor (OXTR). OXT Protein, Human, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 11.6 kDa and the accession number is P01178.

Pack Size	Price	USA Stock	Global Stock
5 µg	$125	20 days	20 days
10 µg	$198	20 days	20 days
20 µg	$341	20 days	20 days
50 µg	$497	20 days	20 days
100 µg	$696	20 days	20 days
200 µg	$1,080	20 days	20 days
500 µg	$1,950	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Batch Information

Select Batch

Purity:98%

Appearance:Lyophilized powder

Color:White

Resource Download

COA User Guide of Recombinant Proteins

Product Introduction

Bioactivity

Bioactivity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	Neurophysin 1 specifically binds oxytocin.; Oxytocin causes contraction of the smooth muscle of the uterus and of the mammary gland. Acts by binding to oxytocin receptor (OXTR). OXT Protein, Human, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 11.6 kDa and the accession number is P01178.
Species	Human
Expression System	P. pastoris (Yeast)
Tag	N-6xHis
Accession Number	P01178
Amino Acid	AAPDLDVRKCLPCGPGGKGRCFGPNICCAEELGCFVGTAEALRCQEENYLPSPCQSGQKACGSGGRCAVLGLCCSPDGCHADPACDAEATFSQR
Construction	32-125 aa
Protein Purity	> 90% as determined by SDS-PAGE.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Tris-based buffer, 50% glycerol
Reconstitution	A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Synonyms	Oxytocin-neurophysin 1, OXT, OT-NPI, OT
Research Background	Neurophysin 1 specifically binds oxytocin.; Oxytocin causes contraction of the smooth muscle of the uterus and of the mammary gland. Acts by binding to oxytocin receptor (OXTR).

Chemical Properties

Molecular Weight

11.6 kDa (predicted)

Storage & Solubility Information

Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.