Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

OXT Protein, Human, Recombinant (His)

TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-01820 Copy Product Info
Neurophysin 1 specifically binds oxytocin.; Oxytocin causes contraction of the smooth muscle of the uterus and of the mammary gland. Acts by binding to oxytocin receptor (OXTR). OXT Protein, Human, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 11.6 kDa and the accession number is P01178.

OXT Protein, Human, Recombinant (His)

Catalog No. TMPH-01820
Copy Product Info
TargetMol | SPR Buffer-Exchangeable

Neurophysin 1 specifically binds oxytocin.; Oxytocin causes contraction of the smooth muscle of the uterus and of the mammary gland. Acts by binding to oxytocin receptor (OXTR). OXT Protein, Human, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 11.6 kDa and the accession number is P01178.

OXT Protein, Human, Recombinant (His)
Pack SizePriceUSA StockGlobal StockQuantity
5 μg$12520 days20 days
10 μg$19820 days20 days
20 μg$34120 days20 days
50 μg$49720 days20 days
100 μg$69620 days20 days
200 μg$1,08020 days20 days
500 μg$1,95020 days20 days
Add to Cart
Add to Quotation
For In stock only · Estimated delivery:USA Stock (1-2 days) Global Stock (5-7 days)
For research use only—not for human use. No sales to individuals. Use as intended only.
Questions
View More

Batch Information

Select Batch

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
Neurophysin 1 specifically binds oxytocin.; Oxytocin causes contraction of the smooth muscle of the uterus and of the mammary gland. Acts by binding to oxytocin receptor (OXTR). OXT Protein, Human, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 11.6 kDa and the accession number is P01178.
Species
Human
Expression System
P. pastoris (Yeast)
TagN-6xHis
Accession NumberP01178
Synonyms
Oxytocin-neurophysin 1,OXT,OT-NPI,OT
Amino Acid
AAPDLDVRKCLPCGPGGKGRCFGPNICCAEELGCFVGTAEALRCQEENYLPSPCQSGQKACGSGGRCAVLGLCCSPDGCHADPACDAEATFSQR
Construction
32-125 aa
Protein Purity
> 90% as determined by SDS-PAGE.
OXT Protein, Human, Recombinant (His)
Molecular Weight11.6 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationTris-based buffer, 50% glycerol
Reconstitution
A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Research Background
Neurophysin 1 specifically binds oxytocin.; Oxytocin causes contraction of the smooth muscle of the uterus and of the mammary gland. Acts by binding to oxytocin receptor (OXTR).

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.