Shopping Cart
  • Remove All
  • TargetMol
    Your shopping cart is currently empty

NKG2D/CD314 Protein, Pig, Recombinant (mFc)

TargetMol | SPR
Catalog No. TMPH-04446

NKG2D/CD314 Protein, Pig, Recombinant (mFc) is expressed in Mammalian cell. The accession number is Q9GLF5.

NKG2D/CD314 Protein, Pig, Recombinant (mFc)

NKG2D/CD314 Protein, Pig, Recombinant (mFc)

TargetMol | SPR
Catalog No. TMPH-04446
NKG2D/CD314 Protein, Pig, Recombinant (mFc) is expressed in Mammalian cell. The accession number is Q9GLF5.
Pack SizePriceAvailabilityQuantity
5 μg$11920 days
10 μg$19820 days
20 μg$33020 days
50 μg$43520 days
100 μg$53720 days
200 μg$98720 days
500 μg$2,38020 days
1 mg$4,56020 days
Bulk & Custom
Add to Cart
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.
Questions
View More

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
NKG2D/CD314 Protein, Pig, Recombinant (mFc) is expressed in Mammalian cell. The accession number is Q9GLF5.
Species
Pig
Expression System
HEK293 Cells
TagN-mFc
Accession NumberQ9GLF5
Synonyms
NKG2-D-activating NK receptor,NKG2-D type II integral membrane protein,NKG2D,NK cell receptor D,KLRK1,Killer cell lectin-like receptor subfamily K member 1,CD314
Amino Acid
NLLFNQEAPSPLKESYCGPCPKNWICYRNSCYQFSNESKTWLQSQASCRSQNSSLLKIYSREDQDFFKLVKSYHWMGLVQIPTNRSWQWEDGSILSPNQITMVEMQNGSCAVYGSSFKGYTENCLTLNTYICMKRTV
Construction
78-214 aa
Protein Purity
> 95% as determined by SDS-PAGE.
Molecular Weight17.2 kDa (Predicted)
EndotoxinNot tested.
FormulationLyophilized from PBS, 6% Trehalose, pH 7.4
Reconstitution
Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 83 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.

Dose Conversion

You can also refer to dose conversion for different animals. More

Sci Citations

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords