Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

NfuA Protein, Vibrio vulnificus, Recombinant

TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-03705 Copy Product Info
Involved in iron-sulfur cluster biogenesis. Binds a 4Fe-4S cluster, can transfer this cluster to apoproteins, and thereby intervenes in the maturation of Fe/S proteins. Could also act as a scaffold/chaperone for damaged Fe/S proteins. NfuA Protein, Vibrio vulnificus, Recombinant is expressed in E. coli expression system. The predicted molecular weight is 21.0 kDa and the accession number is Q8DDU2.

NfuA Protein, Vibrio vulnificus, Recombinant

Catalog No. TMPH-03705
Copy Product Info
TargetMol | SPR Buffer-Exchangeable

Involved in iron-sulfur cluster biogenesis. Binds a 4Fe-4S cluster, can transfer this cluster to apoproteins, and thereby intervenes in the maturation of Fe/S proteins. Could also act as a scaffold/chaperone for damaged Fe/S proteins. NfuA Protein, Vibrio vulnificus, Recombinant is expressed in E. coli expression system. The predicted molecular weight is 21.0 kDa and the accession number is Q8DDU2.

NfuA Protein, Vibrio vulnificus, Recombinant
Pack SizePriceUSA StockGlobal StockQuantity
5 μg$18520 days20 days
10 μg$29720 days20 days
20 μg$51520 days20 days
50 μg$71320 days20 days
100 μg$91620 days20 days
200 μg$1,26020 days20 days
500 μg$1,93020 days20 days
1 mg$2,69020 days20 days
Add to Cart
Add to Quotation
For In stock only · Estimated delivery:USA Stock (1-2 days) Global Stock (5-7 days)
For research use only—not for human use. No sales to individuals. Use as intended only.
Questions
View More

Batch Information

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
Involved in iron-sulfur cluster biogenesis. Binds a 4Fe-4S cluster, can transfer this cluster to apoproteins, and thereby intervenes in the maturation of Fe/S proteins. Could also act as a scaffold/chaperone for damaged Fe/S proteins. NfuA Protein, Vibrio vulnificus, Recombinant is expressed in E. coli expression system. The predicted molecular weight is 21.0 kDa and the accession number is Q8DDU2.
Species
Vibrio vulnificus
Expression System
E. coli
TagTag Free
Accession NumberQ8DDU2
Synonyms
nfuA,Fe/S biogenesis protein NfuA
Amino Acid
MSNITITEAAQTHFANLLGQQPDGTNIRVFVVNPGTQNAECGVSYCPPEAVEATDTEIPYQSFSAYVDELSLPFLEDAEIDYVTDKMGSQLTLKAPNAKMRKVADDAPLLERVEYAIQTQVNPQLAGHGGHVKLMEITDAGVAIVAFGGGCNGCSMVDVTLKEGIEKELLQQFSGELTAVRDATEHDRGDHSYY
Construction
1-194 aa
Protein Purity
> 90% as determined by SDS-PAGE.
Molecular Weight21.0 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationTris-based buffer, 50% glycerol
Reconstitution
A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Research Background
Involved in iron-sulfur cluster biogenesis. Binds a 4Fe-4S cluster, can transfer this cluster to apoproteins, and thereby intervenes in the maturation of Fe/S proteins. Could also act as a scaffold/chaperone for damaged Fe/S proteins.

Citations

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Dose Conversion

You can also refer to dose conversion for different animals. More

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.