Home Tools
Log in
Cart

NfuA Protein, Vibrio vulnificus, Recombinant

Catalog No. TMPH-03705

Involved in iron-sulfur cluster biogenesis. Binds a 4Fe-4S cluster, can transfer this cluster to apoproteins, and thereby intervenes in the maturation of Fe/S proteins. Could also act as a scaffold/chaperone for damaged Fe/S proteins. NfuA Protein, Vibrio vulnificus, Recombinant is expressed in E. coli expression system. The predicted molecular weight is 21.0 kDa and the accession number is Q8DDU2.

All products from TargetMol are for Research Use Only. Not for Human or Veterinary or Therapeutic Use.
NfuA Protein, Vibrio vulnificus, Recombinant
Pack Size Availability Price/USD Quantity
20 μg 20 days $ 515.00
100 μg 20 days $ 833.00
1 mg 20 days $ 2,450.00
Bulk Inquiry
Get quote
Contact us for more batch information
Biological Description
Technical Params
Product Properties
Description Involved in iron-sulfur cluster biogenesis. Binds a 4Fe-4S cluster, can transfer this cluster to apoproteins, and thereby intervenes in the maturation of Fe/S proteins. Could also act as a scaffold/chaperone for damaged Fe/S proteins. NfuA Protein, Vibrio vulnificus, Recombinant is expressed in E. coli expression system. The predicted molecular weight is 21.0 kDa and the accession number is Q8DDU2.
Species Vibrio vulnificus
Expression System E. coli
Tag Tag Free
Accession Number Q8DDU2
Amino Acid MSNITITEAAQTHFANLLGQQPDGTNIRVFVVNPGTQNAECGVSYCPPEAVEATDTEIPYQSFSAYVDELSLPFLEDAEIDYVTDKMGSQLTLKAPNAKMRKVADDAPLLERVEYAIQTQVNPQLAGHGGHVKLMEITDAGVAIVAFGGGCNGCSMVDVTLKEGIEKELLQQFSGELTAVRDATEHDRGDHSYY
Construction 1-194 aa
Protein Purity > 90% as determined by SDS-PAGE.
Molecular Weight 21.0 kDa (predicted)
Formulation Tris-based buffer, 50% glycerol
Reconstitution A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage

Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at-80℃. For reconstituted proteinsolutions, the solution can be stored at -20°c to -80'c for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.

Shipping

In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.

Research Background Involved in iron-sulfur cluster biogenesis. Binds a 4Fe-4S cluster, can transfer this cluster to apoproteins, and thereby intervenes in the maturation of Fe/S proteins. Could also act as a scaffold/chaperone for damaged Fe/S proteins.

Calculator

Reconstitution Calculator
Recombinant Proteins Dilute Calculator
Specific Activity Calculator
=
÷
X
=
X
(Unit/mg)
= 106 ÷
ng/mL

bottom

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords

recombinant recombinant-proteins proteins protein

 

TargetMol