Shopping Cart
Remove All
Your shopping cart is currently empty
NEK9 Protein, Human, Recombinant (His) is expressed in E. coli. The accession number is Q8TD19.

| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 5 μg | $198 | 35 days | 35 days | |
| 10 μg | $338 | 35 days | 35 days | |
| 20 μg | $567 | 35 days | 35 days | |
| 50 μg | $1,130 | 35 days | 35 days | |
| 100 μg | $1,920 | 35 days | 35 days |
| Biological Activity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
| Description | NEK9 Protein, Human, Recombinant (His) is expressed in E. coli. The accession number is Q8TD19. |
| Species | Human |
| Expression System | E. coli |
| Tag | C-6xHis |
| Accession Number | Q8TD19 |
| Synonyms | NimA-related kinase 8,Never in mitosis A-related kinase 9,Nercc1 kinase,NERCC,NEK9,NEK8,KIAA1995 |
| Amino Acid | YIPIRVLGRGAFGEATLYRRTEDDSLVVWKEVDLTRLSEKERRDALNEIVILALLQHDNIIAYYNHFMDNTTLLIELEYCNGGNLYDKILRQKDKLFEEEMVVWYLFQIVSAVSCIHKAGILHRDIKTLNIFLTKANLIKLGDYGLAKKLNSEYSMAETLVGTPYYMSPELCQGVKYNFKSDIWAVGCVIFELLTLKRTFDATNPLNLCVKIVQGIRAMEVDSSQYSLELIQMVHSCLDQDPEQRPTADELLDRPLL |
| Construction | 52-308 aa |
| Protein Purity | > 85% as determined by SDS-PAGE. ![]() |
| Molecular Weight | 36.5 kDa (Predicted); 37 kDa (Reducing conditions) |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4. |
| Reconstitution | Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
| Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
| Shipping | In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice. |
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.