Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

NEK9 Protein, Human, Recombinant (His)

TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-03773 Copy Product Info
NEK9 Protein, Human, Recombinant (His) is expressed in E. coli. The accession number is Q8TD19.

NEK9 Protein, Human, Recombinant (His)

Catalog No. TMPH-03773
Copy Product Info
TargetMol | SPR Buffer-Exchangeable

NEK9 Protein, Human, Recombinant (His) is expressed in E. coli. The accession number is Q8TD19.

NEK9 Protein, Human, Recombinant (His)
Pack SizePriceUSA StockGlobal StockQuantity
5 μg$19835 days35 days
10 μg$33835 days35 days
20 μg$56735 days35 days
50 μg$1,13035 days35 days
100 μg$1,92035 days35 days
Add to Cart
Add to Quotation
For In stock only · Estimated delivery:USA Stock (1-2 days) Global Stock (5-7 days)
For research use only—not for human use. No sales to individuals. Use as intended only.
Questions
View More

Batch Information

Select Batch

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
NEK9 Protein, Human, Recombinant (His) is expressed in E. coli. The accession number is Q8TD19.
Species
Human
Expression System
E. coli
TagC-6xHis
Accession NumberQ8TD19
Synonyms
NimA-related kinase 8,Never in mitosis A-related kinase 9,Nercc1 kinase,NERCC,NEK9,NEK8,KIAA1995
Amino Acid
YIPIRVLGRGAFGEATLYRRTEDDSLVVWKEVDLTRLSEKERRDALNEIVILALLQHDNIIAYYNHFMDNTTLLIELEYCNGGNLYDKILRQKDKLFEEEMVVWYLFQIVSAVSCIHKAGILHRDIKTLNIFLTKANLIKLGDYGLAKKLNSEYSMAETLVGTPYYMSPELCQGVKYNFKSDIWAVGCVIFELLTLKRTFDATNPLNLCVKIVQGIRAMEVDSSQYSLELIQMVHSCLDQDPEQRPTADELLDRPLL
Construction
52-308 aa
Protein Purity
> 85% as determined by SDS-PAGE.
NEK9 Protein, Human, Recombinant (His)
Molecular Weight36.5 kDa (Predicted); 37 kDa (Reducing conditions)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationLyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4.
Reconstitution
Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords