NEK9 Protein, Human, Recombinant (His)

Catalog No. TMPH-03773

NEK9 Protein, Human, Recombinant (His) is expressed in E. coli. The accession number is Q8TD19.

NEK9 Protein, Human, Recombinant (His)

Catalog No. TMPH-03773

NEK9 Protein, Human, Recombinant (His) is expressed in E. coli. The accession number is Q8TD19.

Pack Size	Price	USA Warehouse	Global Warehouse
5 μg	$198	35 days	35 days
10 μg	$338	35 days	35 days
20 μg	$567	35 days	35 days
50 μg	$1,130	35 days	35 days
100 μg	$1,920	35 days	35 days

Add to Cart

Add to Quotation

In Stock Estimated shipping dateUSA Warehouse [1-2 days] Global Warehouse [5-7 days]

All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.

Questions

Select Batch

Resource Download

COA User Guide of Recombinant Proteins

Product Information

Biological Activity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	NEK9 Protein, Human, Recombinant (His) is expressed in E. coli. The accession number is Q8TD19.
Species	Human
Expression System	E. coli
Tag	C-6xHis
Accession Number	Q8TD19
Synonyms	NimA-related kinase 8,Never in mitosis A-related kinase 9,Nercc1 kinase,NERCC,NEK9,NEK8,KIAA1995
Amino Acid	YIPIRVLGRGAFGEATLYRRTEDDSLVVWKEVDLTRLSEKERRDALNEIVILALLQHDNIIAYYNHFMDNTTLLIELEYCNGGNLYDKILRQKDKLFEEEMVVWYLFQIVSAVSCIHKAGILHRDIKTLNIFLTKANLIKLGDYGLAKKLNSEYSMAETLVGTPYYMSPELCQGVKYNFKSDIWAVGCVIFELLTLKRTFDATNPLNLCVKIVQGIRAMEVDSSQYSLELIQMVHSCLDQDPEQRPTADELLDRPLL
Construction	52-308 aa
Protein Purity	> 85% as determined by SDS-PAGE.
Molecular Weight	36.5 kDa (Predicted); 37 kDa (Reducing conditions)
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4.
Reconstitution	Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
Shipping	In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.