Shopping Cart
- Remove All
- Your shopping cart is currently empty
NEK9 Protein, Human, Recombinant (His) is expressed in E. coli. The accession number is Q8TD19.
Pack Size | Price | Availability | Quantity |
---|---|---|---|
100 μg | $1,920 | 35 days |
Biological Activity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
Description | NEK9 Protein, Human, Recombinant (His) is expressed in E. coli. The accession number is Q8TD19. |
Species | Human |
Expression System | E. coli |
Tag | C-6xHis |
Accession Number | Q8TD19 |
Synonyms | NimA-related kinase 8,Never in mitosis A-related kinase 9,Nercc1 kinase,NERCC,NEK9,NEK8,KIAA1995 |
Amino Acid | YIPIRVLGRGAFGEATLYRRTEDDSLVVWKEVDLTRLSEKERRDALNEIVILALLQHDNIIAYYNHFMDNTTLLIELEYCNGGNLYDKILRQKDKLFEEEMVVWYLFQIVSAVSCIHKAGILHRDIKTLNIFLTKANLIKLGDYGLAKKLNSEYSMAETLVGTPYYMSPELCQGVKYNFKSDIWAVGCVIFELLTLKRTFDATNPLNLCVKIVQGIRAMEVDSSQYSLELIQMVHSCLDQDPEQRPTADELLDRPLL |
Construction | 52-308 aa |
Protein Purity | > 85% as determined by SDS-PAGE. ![]() |
Molecular Weight | 36.5 kDa (Predicted); 37 kDa (Reducing conditions) |
Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
Formulation | Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4. |
Reconstitution | Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
Shipping | In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.