Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

NAD2 Protein, Psoroptes ovis, Recombinant (His)

TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-03192

NAD2 Protein, Psoroptes ovis, Recombinant (His) is expressed in E. coli expression system with N-10xHis tag. The predicted molecular weight is 32.7 kDa and the accession number is A0A075XDS2.

NAD2 Protein, Psoroptes ovis, Recombinant (His)

NAD2 Protein, Psoroptes ovis, Recombinant (His)

TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-03192
NAD2 Protein, Psoroptes ovis, Recombinant (His) is expressed in E. coli expression system with N-10xHis tag. The predicted molecular weight is 32.7 kDa and the accession number is A0A075XDS2.
Pack SizePriceUSA WarehouseGlobal WarehouseQuantity
5 μg$52620 days20 days
10 μg$88620 days20 days
20 μg$1,50020 days20 days
50 μg$2,09020 days20 days
100 μg$2,75020 days20 days
Add to Cart
Add to Quotation
In Stock Estimated shipping dateUSA Warehouse [1-2 days] Global Warehouse [5-7 days]
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.
Questions
View More

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
NAD2 Protein, Psoroptes ovis, Recombinant (His) is expressed in E. coli expression system with N-10xHis tag. The predicted molecular weight is 32.7 kDa and the accession number is A0A075XDS2.
Species
Psoroptes ovis
Expression System
E. coli
TagN-10xHis
Accession NumberA0A075XDS2
Synonyms
NADH-ubiquinone oxidoreductase chain 2,NADH dehydrogenase subunit 2,nad2
Amino Acid
GMMSKELKKNSMTSSPSMFYLLVQLPASIIFLIFMTSNPNSKTIMCMGILVMMIKSGAFPFHMWYLKTLGLLNMSSPSMKMIMTWQKIIPFFILSYFKLWELLVILGLMNMLIPLVKMSKLSSMKSILVLSSINNNSWFMMSSLLSFMILSLYFMIYSLSLLITMSFLKSVKKKSFILKENPMETMLVIMNLGGIPPSVMFLGKMIIFTLLVKMNLPKEIMMLMLMMACYFMYHYLWCTFPYLMNTPLKSQNQVMNKNTTFMLTLMMLL
Construction
32-300 aa
Protein Purity
> 85% as determined by SDS-PAGE.
Molecular Weight32.7 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationIf the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.
Research Background
N/A

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords