Myoglobin Protein, Mouse, Recombinant (His & Myc)

Catalog No. TMPH-02795

Serves as a reserve supply of oxygen and facilitates the movement of oxygen within muscles. Myoglobin Protein, Mouse, Recombinant (His & Myc) is expressed in HEK293 mammalian cells with N-10xHis and C-Myc tag. The predicted molecular weight is 21.9 kDa and the accession number is P04247.

Myoglobin Protein, Mouse, Recombinant (His & Myc)

Catalog No. TMPH-02795

Pack Size	Price	Availability
5 μg	$219	20 days
10 μg	$365	20 days
20 μg	$613	20 days
50 μg	$1,160	20 days
100 μg	$1,890	20 days

Bulk & Custom

Add to Cart

All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.

Questions

Resource Download

User Guide of Recombinant Proteins

Product Information

Biological Activity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	Serves as a reserve supply of oxygen and facilitates the movement of oxygen within muscles. Myoglobin Protein, Mouse, Recombinant (His & Myc) is expressed in HEK293 mammalian cells with N-10xHis and C-Myc tag. The predicted molecular weight is 21.9 kDa and the accession number is P04247.
Species	Mouse
Expression System	HEK293 Cells
Tag	N-10xHis, C-Myc
Accession Number	P04247
Synonyms	Pseudoperoxidase MB,Nitrite reductase MB,Myoglobin,Mb
Amino Acid	GLSDGEWQLVLNVWGKVEADLAGHGQEVLIGLFKTHPETLDKFDKFKNLKSEEDMKGSEDLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEIIIEVLKKRHSGDFGADAQGAMSKALELFRNDIAAKYKELGFQG
Construction	2-154 aa
Protein Purity	> 85% as determined by SDS-PAGE.
Molecular Weight	21.9 kDa (predicted)
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Tris-based buffer, 50% glycerol
Reconstitution	A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
Shipping	In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.
Research Background	Serves as a reserve supply of oxygen and facilitates the movement of oxygen within muscles.