Shopping Cart
  • Remove All
  • TargetMol
    Your shopping cart is currently empty

MYO16 Protein, Human, Recombinant (His)

TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-04184

MYO16 Protein, Human, Recombinant (His) is expressed in E. coli with C-6xHis. The accession number is Q9Y6X6.

MYO16 Protein, Human, Recombinant (His)

MYO16 Protein, Human, Recombinant (His)

TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-04184
MYO16 Protein, Human, Recombinant (His) is expressed in E. coli with C-6xHis. The accession number is Q9Y6X6.
Pack SizePriceAvailabilityQuantity
5 μg$9820 days
10 μg$16920 days
20 μg$28320 days
50 μg$39720 days
100 μg$53720 days
200 μg$82820 days
500 μg$1,48020 days
1 mg$2,30020 days
Bulk & Custom
Add to Cart
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.
Questions
View More

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it.
Description
MYO16 Protein, Human, Recombinant (His) is expressed in E. coli with C-6xHis. The accession number is Q9Y6X6.
Species
Human
Expression System
E. coli
TagC-6xHis
Accession NumberQ9Y6X6
Synonyms
Unconventional myosin-XVI,Unconventional myosin-16,NYAP3,Neuronal tyrosine-phosphorylated phosphoinositide-3-kinase adapter 3,MYO16B,MYO16,KIAA0865
Amino Acid
DPNTRLSASYEAVSACLSAAREAANEALARPRPHSDDYSTMKKIPPRKPKRSPNTKLSGSYEEISGSRPGDARPAGAPGAAARVLTPGTPQCALPPAAPPGDEDDSEPVYIEMLGHAARPDSPDPGESVYEEMKCCLPDDGGPGAGSFLLH
Construction
1303-1453 aa
Protein Purity
>95% as determined by SDS-PAGE.
Molecular Weight22.6 kDa (Predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationIf the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.

Dose Conversion

You can also refer to dose conversion for different animals. More

Sci Citations

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords