MYL6 Protein, Human, Recombinant (GST)

Copy Product Info

Catalog No. TMPH-01726

Regulatory light chain of myosin. Does not bind calcium. MYL6 Protein, Human, Recombinant (GST) is expressed in E. coli expression system with N-GST tag. The predicted molecular weight is 43.7 kDa and the accession number is P60660.

MYL6 Protein, Human, Recombinant (GST)

Copy Product Info

Catalog No. TMPH-01726

Pack Size	Price	USA Warehouse	Global Warehouse
5 μg	$75	-	In Stock
10 μg	$119	-	In Stock
20 μg	$198	-	In Stock
50 μg	$297	20 days	20 days
100 μg	$427	20 days	20 days
200 μg	$658	20 days	20 days
500 μg	$1,170	20 days	20 days
1 mg	$1,830	20 days	20 days

Add to Cart

Add to Quotation

In Stock Estimated shipping dateUSA Warehouse [1-2 days] Global Warehouse [5-7 days]

All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.

Questions

Select Batch

Resource Download

COA User Guide of Recombinant Proteins

Product Information

Biological Activity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	Regulatory light chain of myosin. Does not bind calcium. MYL6 Protein, Human, Recombinant (GST) is expressed in E. coli expression system with N-GST tag. The predicted molecular weight is 43.7 kDa and the accession number is P60660.
Species	Human
Expression System	E. coli
Tag	N-GST
Accession Number	P60660
Synonyms	Smooth muscle and nonmuscle myosin light chain alkali 6,Myosin light polypeptide 6,Myosin light chain alkali 3 (Myosin light chain A3),Myosin light chain 3 (MLC-3),MYL6,17 kDa myosin light chain (LC17)
Amino Acid	DFTEDQTAEFKEAFQLFDRTGDGKILYSQCGDVMRALGQNPTNAEVLKVLGNPKSDEMNVKVLDFEHFLPMLQTVAKNKDQGTYEDYVEGLRVFDKEGNGTVMGAEIRHVLVTLGEKMTEEEVEMLVAGHEDSNGCINYEAFVRHILSG
Construction	3-151 aa
Protein Purity	> 90% as determined by SDS-PAGE.
Molecular Weight	43.7 kDa (predicted)
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Tris-based buffer, 50% glycerol
Reconstitution	Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Research Background	Regulatory light chain of myosin. Does not bind calcium.