Shopping Cart
  • Remove All
  • TargetMol
    Your shopping cart is currently empty

MYL12B Protein, Human, Recombinant (His)

Catalog No. TMPH-04025

MYL12B Protein, Human, Recombinant (His) is expressed in E. coli with C-6xHis. The accession number is O14950.

MYL12B Protein, Human, Recombinant (His)

MYL12B Protein, Human, Recombinant (His)

Catalog No. TMPH-04025
MYL12B Protein, Human, Recombinant (His) is expressed in E. coli with C-6xHis. The accession number is O14950.
Pack SizePriceAvailabilityQuantity
20 μg$28320 days
100 μg$53720 days
1 mg$2,30020 days
Bulk & Custom
Add to Cart
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.
Questions
View More

Product Information

Biological Activity
Measured by its binding ability in a functional ELISA. Immobilized Human MYL12B at 2 μg/mL can bind Anti-MYL9 recombinant antibody (CSB-RA015318MA1HU). The EC50 is 7.760-8.646 ng/mL.
Description
MYL12B Protein, Human, Recombinant (His) is expressed in E. coli with C-6xHis. The accession number is O14950.
Species
Human
Expression System
E. coli
TagC-6xHis
Accession NumberO14950
Synonyms
SHUJUN-1,Myosin regulatory light chain MRLC2,Myosin regulatory light chain 2-B, smooth muscle isoform,Myosin regulatory light chain 20 kDa (MLC20),Myosin regulatory light chain 12B,MYLC2B,MYL12B,MRLC2,MLC-2A (MLC-2)
Amino Acid
MSSKKAKTKTTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLASLGKNPTDAYLDAMMNEAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEATGTIQEDYLRELLTTMGDRFTDEEVDELYREAPIDKKGNFNYIEFTRILKHGAKDKDD
Construction
1-172 aa
Protein Purity
>95% as determined by SDS-PAGE.
Molecular Weight26.7 kDa (Predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationLyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.

Dose Conversion

You can also refer to dose conversion for different animals. More

Sci Citations

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords