MYL12B Protein, Human, Recombinant (His)

Name: MYL12B Protein, Human, Recombinant (His)
Brand: TargetMol
SKU: TMPH-04025
Rating: 4.5 (1 reviews)

(Synonyms: SHUJUN-1, Myosin regulatory light chain MRLC2, Myosin regulatory light chain 2-B, smooth muscle isoform, Myosin regulatory light chain 20 kDa (MLC20), Myosin regulatory light chain 12B, MYLC2B, MYL12B, MRLC2, MLC-2A (MLC-2)) Copy Product Info

Synonyms: SHUJUN-1, Myosin regulatory light chain MRLC2, Myosin regulatory light chain 2-B, smooth muscle isoform, Myosin regulatory light chain 20 kDa (MLC20), Myosin regulatory light chain 12B, MYLC2B, MYL12B, MRLC2, MLC-2A (MLC-2)

Catalog No. TMPH-04025 Copy Product Info

MYL12B Protein, Human, Recombinant (His) is expressed in E. coli with C-6xHis. The accession number is O14950.

Customer service consultation

Pack Size	Price	USA Stock	Global Stock
5 μg	$98	20 days	20 days
10 μg	$169	20 days	20 days
20 μg	$283	20 days	20 days
50 μg	$397	20 days	20 days
100 μg	$537	20 days	20 days
200 μg	$828	20 days	20 days
500 μg	$1,480	20 days	20 days
1 mg	$2,300	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Resource Download

User Guide of Recombinant Proteins

Product Introduction

Bioactivity

Bioactivity	Measured by its binding ability in a functional ELISA. Immobilized Human MYL12B at 2 μg/mL can bind Anti-MYL9 recombinant antibody (CSB-RA015318MA1HU). The EC50 is 7.760-8.646 ng/mL.
Description	MYL12B Protein, Human, Recombinant (His) is expressed in E. coli with C-6xHis. The accession number is O14950.
Species	Human
Expression System	E. coli
Tag	C-6xHis
Accession Number	O14950
Amino Acid	MSSKKAKTKTTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLASLGKNPTDAYLDAMMNEAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEATGTIQEDYLRELLTTMGDRFTDEEVDELYREAPIDKKGNFNYIEFTRILKHGAKDKDD
Construction	1-172 aa
Protein Purity	>95% as determined by SDS-PAGE.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
Reconstitution	Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Synonyms	SHUJUN-1, Myosin regulatory light chain MRLC2, Myosin regulatory light chain 2-B, smooth muscle isoform, Myosin regulatory light chain 20 kDa (MLC20), Myosin regulatory light chain 12B, MYLC2B, MYL12B, MRLC2, MLC-2A (MLC-2)

Chemical Properties

Molecular Weight

26.7 kDa (Predicted)

Storage & Solubility Information

Storage

Lyophilized powder: -20~-80°C for 1 year | Solution: -80°C for 6 months

Calculator

Molarity Calculator
Dilution Calculator
Reconstitution Calculator
Molecular Weight Calculator

Dose Conversion

You can also refer to dose conversion for different animals. More Dose Conversion

Tech Support

Please see Inhibitor Handling Instructions for more frequently ask questions. Topics include: how to prepare stock solutions, how to store products, and cautions on cell-based assays & animal experiments, etc

Keywords

SHUJUN1MRLC 2MLC2A (MLC-2)MLC20MLC 20

Related Tags: MYL12B Protein, Human, Recombinant (His) chemical structure | MYL12B Protein, Human, Recombinant (His) molecular weight