Shopping Cart
Remove All
Your shopping cart is currently empty
MYL12A Protein, Human, Recombinant (His) is expressed in E. coli with C-6xHis. The accession number is P19105.

| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 5 μg | $98 | 20 days | 20 days | |
| 10 μg | $169 | 20 days | 20 days | |
| 20 μg | $283 | 20 days | 20 days | |
| 50 μg | $397 | 20 days | 20 days | |
| 100 μg | $537 | 20 days | 20 days | |
| 200 μg | $828 | 20 days | 20 days | |
| 500 μg | $1,480 | 20 days | 20 days | |
| 1 mg | $2,300 | 20 days | 20 days |
| Biological Activity | Measured by its binding ability in a functional ELISA. Immobilized Human MYL12A at 2 μg/mL can bind Anti-MYL9 recombinant antibody (CSB-RA015318MA1HU). The EC50 is 5.325-6.456 ng/mL. |
| Description | MYL12A Protein, Human, Recombinant (His) is expressed in E. coli with C-6xHis. The accession number is P19105. |
| Species | Human |
| Expression System | E. coli |
| Tag | C-6xHis |
| Accession Number | P19105 |
| Synonyms | RLC,Myosin RLC,Myosin regulatory light chain MRLC3,Myosin regulatory light chain 2, nonsarcomeric,Myosin regulatory light chain 12A,MYL12A,MRLC3,MLCB,MLC-2B,Epididymis secretory protein Li 24 (HEL-S-24) |
| Amino Acid | MSSKRTKTKTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLASLGKNPTDEYLDAMMNEAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEATGTIQEDYLRELLTTMGDRFTDEEVDELYREAPIDKKGNFNYIEFTRILKHGAKDKDD |
| Construction | 1-171 aa |
| Protein Purity | >95% as determined by SDS-PAGE. |
| Molecular Weight | 26.7 kDa (Predicted) |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4 |
| Reconstitution | Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
| Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
| Shipping | In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice. |
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.