Shopping Cart
  • Remove All
  • TargetMol
    Your shopping cart is currently empty

Murine polyomavirus (MPyV) (strain Kilham) VP2 Protein (His)

TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-02986

Murine polyomavirus (MPyV) (strain Kilham) VP2 Protein (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 41.4 kDa and the accession number is P24596.

Murine polyomavirus (MPyV) (strain Kilham) VP2 Protein (His)

Murine polyomavirus (MPyV) (strain Kilham) VP2 Protein (His)

TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-02986
Murine polyomavirus (MPyV) (strain Kilham) VP2 Protein (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 41.4 kDa and the accession number is P24596.
Pack SizePriceAvailabilityQuantity
5 μg$12920 days
10 μg$21620 days
20 μg$36020 days
50 μg$54320 days
100 μg$74520 days
200 μg$1,07020 days
500 μg$1,73020 days
1 mg$2,53020 days
Bulk & Custom
Add to Cart
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.
Questions
View More

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
Murine polyomavirus (MPyV) (strain Kilham) VP2 Protein (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 41.4 kDa and the accession number is P24596.
Species
MPyV
Expression System
E. coli
TagN-6xHis
Accession NumberP24596
Synonyms
Minor structural protein VP2,Minor capsid protein VP2
Amino Acid
GAFLAVLAEVFDLASITGLSVESILSGEALTTAELLQSHINNLVVYGGLTEAEALAAVEVTPQAFAALTSLFPNFPQALGALAATEFTATGALTVGAAVSAALYPYYWDYRTPVADLNMALQIWYPDLDILFPGALPFARFVNYIDPANWAADLYRAVGRYFWERVQAAGINFIEQQMETGRELAMRSVTSLSETLSQYFENARWAVSGLSTSLYHGLESYYSQLGLSPIQQRQLARNLGHPQPYRYDLYDAPQLKGQVSATYVTKVDPPGGANQRSAPDWMLPLLLGLYGDLTPSWKDTLEELEAEEDGSHSQKAKRRKTKA
Construction
2-324 aa
Protein Purity
> 85% as determined by SDS-PAGE.
Molecular Weight41.4 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationIf the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.
Research Background
Isoform VP2 is a structural protein that resides within the core of the capsid surrounded by 72 VP1 pentamers. Participates in host cell receptor binding together with VP1. Following virus endocytosis and trafficking to the endoplasmic reticulum, VP2 and VP3 form oligomers and integrate into the endoplasmic reticulum membrane. Heterooligomer VP2-VP3 may create a viroporin for transporting the viral genome across the endoplasmic reticulum membrane to the cytoplasm. Nuclear entry of the viral DNA involves the selective exposure and importin recognition of VP2 or Vp3 nuclear localization signal (shared C-terminus). Plays a role in virion assembly within the nucleus in particular through a DNA-binding domain located in the C-terminal region. A N-terminal myristoylation suggests a scaffold function for virion assembly.; structural protein that resides within the core of the capsid surrounded by 72 VP1 pentamers. Following virus endocytosis and trafficking to the endoplasmic reticulum, VP2 and VP3 form oligomers and integrate into the endoplasmic reticulum membrane. Heterooligomer VP2-VP3 may create a viroporin for transporting the viral genome across the endoplasmic reticulum membrane to the cytoplasm. Nuclear entry of the viral DNA involves the selective exposure and importin recognition of VP2 or Vp3 nuclear localization signal (shared C-terminus). Isoform VP3 plays a role in virion assembly within the nucleus.

Dose Conversion

You can also refer to dose conversion for different animals. More

Sci Citations

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.