Shopping Cart
Remove All
Your shopping cart is currently empty
Murine polyomavirus (MPyV) (strain Kilham) VP2 Protein (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 41.4 kDa and the accession number is P24596.

| Pack Size | Price | USA Warehouse | Global Warehouse | Quantity |
|---|---|---|---|---|
| 5 μg | $129 | 20 days | 20 days | |
| 10 μg | $216 | 20 days | 20 days | |
| 20 μg | $360 | 20 days | 20 days | |
| 50 μg | $543 | 20 days | 20 days | |
| 100 μg | $745 | 20 days | 20 days | |
| 200 μg | $1,070 | 20 days | 20 days | |
| 500 μg | $1,730 | 20 days | 20 days | |
| 1 mg | $2,530 | 20 days | 20 days |
| Biological Activity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
| Description | Murine polyomavirus (MPyV) (strain Kilham) VP2 Protein (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 41.4 kDa and the accession number is P24596. |
| Species | MPyV |
| Expression System | E. coli |
| Tag | N-6xHis |
| Accession Number | P24596 |
| Synonyms | Minor structural protein VP2,Minor capsid protein VP2 |
| Amino Acid | GAFLAVLAEVFDLASITGLSVESILSGEALTTAELLQSHINNLVVYGGLTEAEALAAVEVTPQAFAALTSLFPNFPQALGALAATEFTATGALTVGAAVSAALYPYYWDYRTPVADLNMALQIWYPDLDILFPGALPFARFVNYIDPANWAADLYRAVGRYFWERVQAAGINFIEQQMETGRELAMRSVTSLSETLSQYFENARWAVSGLSTSLYHGLESYYSQLGLSPIQQRQLARNLGHPQPYRYDLYDAPQLKGQVSATYVTKVDPPGGANQRSAPDWMLPLLLGLYGDLTPSWKDTLEELEAEEDGSHSQKAKRRKTKA |
| Construction | 2-324 aa |
| Protein Purity | > 85% as determined by SDS-PAGE. |
| Molecular Weight | 41.4 kDa (predicted) |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
| Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
| Shipping | In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice. |
| Research Background | Isoform VP2 is a structural protein that resides within the core of the capsid surrounded by 72 VP1 pentamers. Participates in host cell receptor binding together with VP1. Following virus endocytosis and trafficking to the endoplasmic reticulum, VP2 and VP3 form oligomers and integrate into the endoplasmic reticulum membrane. Heterooligomer VP2-VP3 may create a viroporin for transporting the viral genome across the endoplasmic reticulum membrane to the cytoplasm. Nuclear entry of the viral DNA involves the selective exposure and importin recognition of VP2 or Vp3 nuclear localization signal (shared C-terminus). Plays a role in virion assembly within the nucleus in particular through a DNA-binding domain located in the C-terminal region. A N-terminal myristoylation suggests a scaffold function for virion assembly.; structural protein that resides within the core of the capsid surrounded by 72 VP1 pentamers. Following virus endocytosis and trafficking to the endoplasmic reticulum, VP2 and VP3 form oligomers and integrate into the endoplasmic reticulum membrane. Heterooligomer VP2-VP3 may create a viroporin for transporting the viral genome across the endoplasmic reticulum membrane to the cytoplasm. Nuclear entry of the viral DNA involves the selective exposure and importin recognition of VP2 or Vp3 nuclear localization signal (shared C-terminus). Isoform VP3 plays a role in virion assembly within the nucleus. |
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.