Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

MsyB Protein, E. coli, Recombinant (His)

TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-00570 Copy Product Info
Could participate in the normal pathway of protein export. MsyB Protein, E. coli, Recombinant (His) is expressed in Baculovirus insect cells with C-6xHis tag. The predicted molecular weight is 16.3 kDa and the accession number is P25738.

MsyB Protein, E. coli, Recombinant (His)

Catalog No. TMPH-00570
Copy Product Info
TargetMol | SPR Buffer-Exchangeable

Could participate in the normal pathway of protein export. MsyB Protein, E. coli, Recombinant (His) is expressed in Baculovirus insect cells with C-6xHis tag. The predicted molecular weight is 16.3 kDa and the accession number is P25738.

MsyB Protein, E. coli, Recombinant (His)
Pack SizePriceUSA StockGlobal StockQuantity
5 μg$17620 days20 days
10 μg$29320 days20 days
20 μg$49120 days20 days
50 μg$92620 days20 days
100 μg$1,50020 days20 days
Add to Cart
Add to Quotation
For In stock only · Estimated delivery:USA Stock (1-2 days) Global Stock (5-7 days)
For research use only—not for human use. No sales to individuals. Use as intended only.
Questions
View More

Batch Information

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
Could participate in the normal pathway of protein export. MsyB Protein, E. coli, Recombinant (His) is expressed in Baculovirus insect cells with C-6xHis tag. The predicted molecular weight is 16.3 kDa and the accession number is P25738.
Species
E. coli
Expression System
Baculovirus Insect Cells
TagC-6xHis
Accession NumberP25738
Synonyms
msyB,Acidic protein MsyB
Amino Acid
MTMYATLEEAIDAAREEFLADNPGIDAEDANVQQFNAQKYVLQDGDIMWQVEFFADEGEEGECLPMLSGEAAQSVFDGDYDEIEIRQEWQEENTLHEWDEGEFQLEPPLDTEEGRAAADEWDER
Construction
1-124 aa
Protein Purity
> 85% as determined by SDS-PAGE.
Molecular Weight16.3 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationTris-based buffer, 50% glycerol
Reconstitution
A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Research Background
Could participate in the normal pathway of protein export.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.