Shopping Cart
  • Remove All
  • TargetMol
    Your shopping cart is currently empty

MPT64 Protein, Mycobacterium tuberculosis, Recombinant (His)

TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-03016

MPT64 Protein, Mycobacterium tuberculosis, Recombinant (His) is expressed in Yeast.

MPT64 Protein, Mycobacterium tuberculosis, Recombinant (His)

MPT64 Protein, Mycobacterium tuberculosis, Recombinant (His)

TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-03016
MPT64 Protein, Mycobacterium tuberculosis, Recombinant (His) is expressed in Yeast.
Pack SizePriceAvailabilityQuantity
5 μg$14320 days
10 μg$23820 days
20 μg$39720 days
50 μg$59720 days
100 μg$84520 days
200 μg$1,19020 days
500 μg$1,95020 days
Bulk & Custom
Add to Cart
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.
Questions
View More

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
MPT64 Protein, Mycobacterium tuberculosis, Recombinant (His) is expressed in Yeast.
Species
Mycobacterium tuberculosis
Expression System
P. pastoris (Yeast)
TagN-6xHis
Accession NumberP9WIN9
Synonyms
mpt64,Immunogenic protein MPT64,Antigen MPT64
Amino Acid
APKTYCEELKGTDTGQACQIQMSDPAYNINISLPSYYPDQKSLENYIAQTRDKFLSAATSSTPREAPYELNITSATYQSAIPPRGTQAVVLKVYQNAGGTHPTTTYKAFDWDQAYRKPITYDTLWQADTDPLPVVFPIVQGELSKQTGQQVSIAPNAGLDPVNYQNFAVTNDGVIFFFNPGELLPEAAGPTQVLVPRSAIDSMLA
Construction
24-228 aa
Protein Purity
> 90% as determined by SDS-PAGE.
Molecular Weight24.4 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationTris-based buffer, 50% glycerol
Reconstitution
A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.
Research Background
N/A

Dose Conversion

You can also refer to dose conversion for different animals. More

Sci Citations

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords