Shopping Cart
  • Remove All
  • TargetMol
    Your shopping cart is currently empty

MPT51 Protein, Mycobacterium tuberculosis, Recombinant (His & SUMO)

Catalog No. TMPH-03019

May have a role in host tissue attachment, whereby ligands may include the serum protein fibronectin and small sugars. MPT51 Protein, Mycobacterium tuberculosis, Recombinant (His & SUMO) is expressed in E. coli expression system with N-6xHis-SUMO tag. The predicted molecular weight is 44.5 kDa and the accession number is P9WQN6.

MPT51 Protein, Mycobacterium tuberculosis, Recombinant (His & SUMO)

MPT51 Protein, Mycobacterium tuberculosis, Recombinant (His & SUMO)

Catalog No. TMPH-03019
May have a role in host tissue attachment, whereby ligands may include the serum protein fibronectin and small sugars. MPT51 Protein, Mycobacterium tuberculosis, Recombinant (His & SUMO) is expressed in E. coli expression system with N-6xHis-SUMO tag. The predicted molecular weight is 44.5 kDa and the accession number is P9WQN6.
Pack SizePriceAvailabilityQuantity
20 μg $36020 days
100 μg $74520 days
1 mg $2,53020 days
Bulk & Custom
Add to Cart
Questions
View More
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
May have a role in host tissue attachment, whereby ligands may include the serum protein fibronectin and small sugars. MPT51 Protein, Mycobacterium tuberculosis, Recombinant (His & SUMO) is expressed in E. coli expression system with N-6xHis-SUMO tag. The predicted molecular weight is 44.5 kDa and the accession number is P9WQN6.
Species
Mycobacterium tuberculosis
Expression System
E. coli
TagN-6xHis-SUMO
Accession NumberP9WQN6
Synonyms
MPT51/MPB51 antigen,mpt51,mpb51,fbpD,fbpC1
Amino Acid
AEPTAKAAPYENLMVPSPSMGRDIPVAFLAGGPHAVYLLDAFNAGPDVSNWVTAGNAMNTLAGKGISVVAPAGGAYSMYTNWEQDGSKQWDTFLSAELPDWLAANRGLAPGGHAAVGAAQGGYGAMALAAFHPDRFGFAGSMSGFLYPSNTTTNGAIAAGMQQFGGVDTNGMWGAPQLGRWKWHDPWVHASLLAQNNTRVWVWSPTNPGASDPAAMIGQAAEAMGNSRMFYNQYRSVGGHNGHFDFPASGDNGWGSWAPQLGAMSGDIVGAIR
Construction
27-299 aa
Protein Purity
> 90% as determined by SDS-PAGE.
Molecular Weight44.5 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationTris-based buffer, 50% glycerol
Reconstitution
A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.
Research Background
May have a role in host tissue attachment, whereby ligands may include the serum protein fibronectin and small sugars.

Dose Conversion

You can also refer to dose conversion for different animals. More

Sci Citations

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords