Miraculin Protein, Synsepalum dulcificum, Recombinant (His)

Catalog No. TMPH-03617 Copy Product Info

Miraculin has the property of modifying a sour taste into a sweet taste. This alteration of taste perception persists for many minutes. Miraculin Protein, Synsepalum dulcificum, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 23.4 kDa and the accession number is P13087.

Miraculin Protein, Synsepalum dulcificum, Recombinant (His)

Catalog No. TMPH-03617

Copy Product Info

Miraculin Protein, Synsepalum dulcificum, Recombinant (His)

Pack Size	Price	USA Stock	Global Stock
5 μg	$143	20 days	20 days
10 μg	$238	20 days	20 days
20 μg	$397	-	In Stock
50 μg	$597	20 days	20 days
100 μg	$845	20 days	20 days
200 μg	$1,190	20 days	20 days
500 μg	$1,950	20 days	20 days

Add to Cart

Add to Quotation

For In stock only · Estimated delivery:USA Stock (1-2 days) Global Stock (5-7 days)

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Batch Information

Select Batch

Resource Download

COA User Guide of Recombinant Proteins

Product Information

Biological Activity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	Miraculin has the property of modifying a sour taste into a sweet taste. This alteration of taste perception persists for many minutes. Miraculin Protein, Synsepalum dulcificum, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 23.4 kDa and the accession number is P13087.
Species	Synsepalum dulcificum
Expression System	P. pastoris (Yeast)
Tag	N-6xHis
Accession Number	P13087
Synonyms	Miraculin,MIR
Amino Acid	DSAPNPVLDIDGEKLRTGTNYYIVPVLRDHGGGLTVSATTPNGTFVCPPRVVQTRKEVDHDRPLAFFPENPKEDVVRVSTDLNINFSAFMPCRWTSSTVWRLDKYDESTGQYFVTIGGVKGNPGPETISSWFKIEEFCGSGFYKLVFCPTVCGSCKVKCGDVGIYIDQKGRRRLALSDKPFAFEFNKTVYF
Construction	30-220 aa
Protein Purity	> 85% as determined by SDS-PAGE.
Molecular Weight	23.4 kDa (predicted)
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Tris-based buffer, 50% glycerol
Reconstitution	Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Research Background	Miraculin has the property of modifying a sour taste into a sweet taste. This alteration of taste perception persists for many minutes.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

Reconstitution Calculator
Recombinant Protein Dilution Calculator
Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.