Shopping Cart
  • Remove All
  • TargetMol
    Your shopping cart is currently empty

MIP-1 alpha/CCL3 Protein, Mouse, Recombinant (Active)

TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-04230

MIP-1 alpha/CCL3 Protein, Mouse, Recombinant (Active) is expressed in E. coli with Tag Free. The accession number is P10855.

MIP-1 alpha/CCL3 Protein, Mouse, Recombinant (Active)

MIP-1 alpha/CCL3 Protein, Mouse, Recombinant (Active)

TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-04230
MIP-1 alpha/CCL3 Protein, Mouse, Recombinant (Active) is expressed in E. coli with Tag Free. The accession number is P10855.
Pack SizePriceAvailabilityQuantity
5 μg$2237-10 days
10 μg$3687-10 days
20 μg$5297-10 days
50 μg$8487-10 days
100 μg$1,2207-10 days
200 μg$1,7207-10 days
500 μg$2,7307-10 days
Bulk & Custom
Add to Cart
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.
Questions
View More

Product Information

Biological Activity
Fully biologically active when compared to standard. The biological activity determined by a chemoattract bioassay using murine splenocytes is in a concentration range of 10-100 ng/ml.
Description
MIP-1 alpha/CCL3 Protein, Mouse, Recombinant (Active) is expressed in E. coli with Tag Free. The accession number is P10855.
Species
Mouse
Expression System
E. coli
TagTag Free
Accession NumberP10855
Synonyms
TY-5,Small-inducible cytokine A3,SIS-alpha,Scya3,Mip1a,Macrophage inflammatory protein 1-alpha (MIP-1-alpha),L2G25B,Heparin-binding chemotaxis protein,Ccl3,C-C motif chemokine 3
Amino Acid
APYGADTPTACCFSYSRKIPRQFIVDYFETSSLCSQPGVIFLTKRNRQICADSKETWVQEYITDLELNA
Construction
24-92 aa
Protein Purity
>98% as determined by SDS-PAGE.
Molecular Weight7.9 kDa (Predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationLyophilized from a 0.2 μm filtered concentrated solution in 30 % Acetonitrile and 0.1 % TFA
Reconstitution
Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.

Dose Conversion

You can also refer to dose conversion for different animals. More

Sci Citations

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords