Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

MEOX1 Protein, Human, Recombinant (GST)

TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-04819 Copy Product Info
MEOX1 Protein, Human, Recombinant (GST) is exppressed in E. coli. The accession number is P50221.

MEOX1 Protein, Human, Recombinant (GST)

Catalog No. TMPH-04819
Copy Product Info
TargetMol | SPR Buffer-Exchangeable

MEOX1 Protein, Human, Recombinant (GST) is exppressed in E. coli. The accession number is P50221.

MEOX1 Protein, Human, Recombinant (GST)
Pack SizePriceUSA StockGlobal StockQuantity
5 μg$11920 days20 days
10 μg$19120 days20 days
20 μg$30620 days20 days
50 μg$44320 days20 days
100 μg$57920 days20 days
1 mg$2,47020 days20 days
Add to Cart
Add to Quotation
For In stock only · Estimated delivery:USA Stock (1-2 days) Global Stock (5-7 days)
For research use only—not for human use. No sales to individuals. Use as intended only.
Questions
View More

Batch Information

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it.
Description
MEOX1 Protein, Human, Recombinant (GST) is exppressed in E. coli. The accession number is P50221.
Species
Human
Expression System
E. coli
TagN-GST
Accession NumberP50221
Synonyms
MOX1,Mesenchyme homeobox 1,MEOX1,Homeobox protein MOX-1
Amino Acid
MDPAASSCMRSLQPPAPVWGCLRNPHSEGNGASGLPHYPPTPFSFHQKPDFLATATAAYPDFSASCLAATPHSLPQEEHIFTEQHPAFPQSPNWHFPVSDARRRPNSGPAGGSKEMGTSSLGLVDTTGGPGDDYGVLGSTANETEKKSSRRRKESSDNQENRGKPEGSSKARKERTAFTKEQLRELEAEFAHHNYLTRLRRYEIAVNLDLSERQVKVWFQNRRMKWKRVKGGQPISPNGQDPEDGDSTASPSSE
Construction
1-254 aa
Protein Purity
> 90% as determined by SDS-PAGE.
Molecular Weight55.0 kDa (Predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationTris/PBS-based buffer
Reconstitution
Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage
It is recommended to store recombinant proteins at -20°C to -80°C for future use. Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords