Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

MDC/CCL22 Protein, Mouse, Recombinant

Copy Product Info
TargetMol | SPR
Catalog No. TMPH-04225

MDC/CCL22 Protein, Mouse, Recombinant is expressed in E. coli with Tag Free. The accession number is O88430.

MDC/CCL22 Protein, Mouse, Recombinant

MDC/CCL22 Protein, Mouse, Recombinant

Copy Product Info
TargetMol | SPR
Catalog No. TMPH-04225
MDC/CCL22 Protein, Mouse, Recombinant is expressed in E. coli with Tag Free. The accession number is O88430.
Pack SizePriceUSA WarehouseGlobal WarehouseQuantity
5 μg$1477-10 days7-10 days
10 μg$2467-10 days7-10 days
20 μg$4167-10 days7-10 days
50 μg$8537-10 days7-10 days
100 μg$1,4607-10 days7-10 days
200 μg$1,9807-10 days7-10 days
500 μg$3,3007-10 days7-10 days
Add to Cart
Add to Quotation
In Stock Estimated shipping dateUSA Warehouse [1-2 days] Global Warehouse [5-7 days]
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.
Questions
View More

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it.
Description
MDC/CCL22 Protein, Mouse, Recombinant is expressed in E. coli with Tag Free. The accession number is O88430.
Species
Mouse
Expression System
E. coli
TagTag Free
Accession NumberO88430
Synonyms
Small-inducible cytokine A22,Scya22,Ccl22,C-C motif chemokine 22,CC chemokine ABCD-1,Activated B and dendritic cell-derived,Abcd1
Amino Acid
GPYGANVEDSICCQDYIRHPLPSRLVKEFFWTSKSCRKPGVVLITVKNRDICADPRQVWVKKLLHKLS
Construction
25-92 aa
Protein Purity
>97% as determined by SDS-PAGE.
Molecular Weight7.8 kDa (Predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationLyophilized from a 0.2 µm filtered concentrated solution in 2×PBS, 5% Trehalose, 0.02% Tween-20, pH 7.0.
Reconstitution
Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords