Shopping Cart
  • Remove All
  • TargetMol
    Your shopping cart is currently empty

MCP-3/CCL7 Protein, Mouse, Recombinant

TargetMol | SPR
Catalog No. TMPH-04234

MCP-3/CCL7 Protein, Mouse, Recombinant is expressed in E. coli with Tag Free. The accession number is Q03366.

MCP-3/CCL7 Protein, Mouse, Recombinant

MCP-3/CCL7 Protein, Mouse, Recombinant

TargetMol | SPR
Catalog No. TMPH-04234
MCP-3/CCL7 Protein, Mouse, Recombinant is expressed in E. coli with Tag Free. The accession number is Q03366.
Pack SizePriceAvailabilityQuantity
5 μg$19720 days
10 μg$32820 days
20 μg$49520 days
50 μg$85620 days
100 μg$1,30020 days
200 μg$1,83020 days
500 μg$2,92020 days
Bulk & Custom
Add to Cart
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.
Questions
View More

Product Information

Biological Activity
Fully biologically active when compared to standard. The biologically active determined by a chemotaxis bioassay using human monocytes is in a concentration range of 100-300 ng/ml.
Description
MCP-3/CCL7 Protein, Mouse, Recombinant is expressed in E. coli with Tag Free. The accession number is Q03366.
Species
Mouse
Expression System
E. coli
TagTag Free
Accession NumberQ03366
Synonyms
Small-inducible cytokine A7,Scya7,Protein FIC,Monocyte chemotactic protein 3 (MCP-3),Monocyte chemoattractant protein 3,Mcp3,Intercrine/chemokine MARC,Fic,Ccl7,C-C motif chemokine 7
Amino Acid
QPDGPNASTCCYVKKQKIPKRNLKSYRRITSSRCPWEAVIFKTKKGMEVCAEAHQKWVEEAIAYLDMKTPTPKP
Construction
24-97 aa
Protein Purity
>95% as determined by SDS-PAGE.
Molecular Weight8.5 kDa (Predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationLyophilized from a 0.2 µm filtered 2xPBS, pH 7.4
Reconstitution
Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.

Dose Conversion

You can also refer to dose conversion for different animals. More

Sci Citations

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords