Shopping Cart
Remove All
Your shopping cart is currently empty
MAP2K3 Protein, Human, Recombinant (His & Avi) is expressed in E. coli with C-6xHis-Avi. The accession number is P46734.

| Pack Size | Price | USA Warehouse | Global Warehouse | Quantity |
|---|---|---|---|---|
| 5 μg | $75 | 20 days | 20 days | |
| 10 μg | $119 | 20 days | 20 days | |
| 20 μg | $198 | 20 days | 20 days | |
| 50 μg | $288 | 20 days | 20 days | |
| 100 μg | $389 | 20 days | 20 days | |
| 200 μg | $589 | 20 days | 20 days | |
| 500 μg | $1,070 | 20 days | 20 days | |
| 1 mg | $1,680 | 20 days | 20 days |
| Biological Activity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. |
| Description | MAP2K3 Protein, Human, Recombinant (His & Avi) is expressed in E. coli with C-6xHis-Avi. The accession number is P46734. |
| Species | Human |
| Expression System | E. coli |
| Tag | C-6xHis-Avi |
| Accession Number | P46734 |
| Synonyms | Stress-activated protein kinase kinase 2 (SAPK kinase 2;SAPKK-2;SAPKK2),SKK2,PRKMK3,MKK3,MEK3,MAPKK 3,MAPK/ERK kinase 3 (MEK 3),MAP2K3,MAP kinase kinase 3,Dual specificity mitogen-activated protein kinase kinase 3 |
| Amino Acid | MESPASSQPASMPQSKGKSKRKKDLRISCMSKPPAPNPTPPRNLDSRTFITIGDRNFEVEADDLVTISELGRGAYGVVEKVRHAQSGTIMAVKRIRATVNSQEQKRLLMDLDINMRTVDCFYTVTFYGALFREGDVWICMELMDTSLDKFYRKVLDKNMTIPEDILGEIAVSIVRALEHLHSKLSVIHRDVKPSNVLINKEGHVKMCDFGISGYLVDSVAKTMDAGCKPYMAPERINPELNQKGYNVKSDVWSLGITMIEMAILRFPYESWGTPFQQLKQVVEEPSPQLPADRFSPEFVDFTAQCLRKNPAERMSYLELMEHPFFTLHKTKKTDIAAFVKEILGEDS |
| Construction | 1-347 aa |
| Protein Purity | >95% as determined by SDS-PAGE. |
| Molecular Weight | 42 kDa (Predicted) |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
| Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
| Shipping | In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice. |
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.